Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22600 109 / 1e-30 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 105 / 4e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 91 / 3e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 82 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G09370 76 / 3e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G13820 71 / 4e-16 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G64080 69 / 8e-15 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 64 / 5e-13 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G55260 62 / 7e-12 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT1G36150 57 / 3e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021912 [exp] 208 / 2e-69 AT3G22600 125 / 7e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010572 [exp] 139 / 2e-42 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 138 / 7e-42 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 105 / 7e-29 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042611 [exp] 97 / 6e-26 AT3G22600 142 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10022066 [exp] 84 / 1e-20 AT3G22600 121 / 2e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039349 [exp] 82 / 3e-20 AT3G22600 119 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10010573 [exp] 82 / 3e-20 AT3G22600 117 / 5e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10042612 [exp] 84 / 4e-20 AT3G22600 121 / 9e-35 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G155100 [exp] 131 / 3e-39 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085400 [exp] 130 / 4e-39 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211800 [exp] 100 / 5e-27 AT3G22600 160 / 6e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050500 [exp] 95 / 6e-25 AT3G22600 129 / 2e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 92 / 2e-23 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.010G085300 [exp] 91 / 2e-23 AT3G22600 66 / 5e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050300 [exp] 83 / 3e-20 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G211900 [exp] 82 / 5e-20 AT2G48130 89 / 3e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G020200 [exp] 76 / 1e-17 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.009G158100 [exp] 71 / 1e-15 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10041197 pacid=23179871 polypeptide=Lus10041197 locus=Lus10041197.g ID=Lus10041197.BGIv1.0 annot-version=v1.0 ATGGCGGGCAGAAACATTGCATCGAGTTTGGGCATTCTGTTGCTTACCATCCAGCTATTGGCAGGAGGAGTGATGGTCATGGCTCAGTCTGATTGTTCCA CCGTGCTACTTACCTTATCTCCCTGCCTGGATTACATGTCCAGTAAATCGCCGACTCCCTCGCAGCAATGCTGTAGCCAGTTCGAGTCGGTGGTTCGTTC TGCTCCAATGTGCCTGTGTCAGGTTCTTGAAGGCGGTGGTTCTTCATTTGGCGTCGAACTCAACCATACTCGGGCCTTGGAATTACCCGCTGCTTGTAAA ATCGAGGCCCCGCCTGCTAGCAACTGCAATGCTACTTCTCCAACTACAGCTCCCCTCGGGAGCGAAGAACCAGCAACTCCAACTACTCCAGGTGAATCTG GAAGCGAGGCAGGAAGTGGTACGTCCAATGGGAGGAGCTCCATGAAGGTTTCGATGTCTTCGCTCTTCTTCTTTCTCTTTGCAGCCTCATTTTTTTCCAT GAGATACTAA
AA sequence Show only first row Show all	>Lus10041197 pacid=23179871 polypeptide=Lus10041197 locus=Lus10041197.g ID=Lus10041197.BGIv1.0 annot-version=v1.0 MAGRNIASSLGILLLTIQLLAGGVMVMAQSDCSTVLLTLSPCLDYMSSKSPTPSQQCCSQFESVVRSAPMCLCQVLEGGGSSFGVELNHTRALELPAACK IEAPPASNCNATSPTTAPLGSEEPATPTTPGESGSEAGSGTSNGRSSMKVSMSSLFFFLFAASFFSMRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10041197 [exp]	0	1
					Lus10016958 [exp]	1.0	0.9621
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10040791 [exp]	1.4	0.9481
AT2G36870		XTH32	xyloglucan endotransglucosylas...		Lus10041341 [exp]	1.7	0.9421
AT1G27930			Protein of unknown function (D...		Lus10012537 [exp]	2.8	0.9410
AT4G16780	HD	ATHB2, HAT4, AT...	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10040175 [exp]	3.2	0.9392
AT1G34060			Pyridoxal phosphate (PLP)-depe...		Lus10007085 [exp]	3.5	0.9361
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10039268 [exp]	4.2	0.9243
					Lus10003411 [exp]	5.3	0.9110
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10025006 [exp]	5.9	0.9321
AT5G59050			unknown protein		Lus10001626 [exp]	8.3	0.8932

Compare expression of checked genes

Lus10041197 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.