Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22560 128 / 5e-39 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT2G32030 102 / 7e-29 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) AT2G32020 98 / 5e-27 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021914 [exp] 180 / 2e-59 AT3G22560 216 / 2e-72 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10010570 [exp] 95 / 8e-26 AT2G32030 220 / 7e-74 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10039343 [exp] 94 / 3e-25 AT3G22560 151 / 1e-46 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10039344 [exp] 91 / 4e-24 AT2G32030 236 / 4e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10006668 [exp] 86 / 3e-22 AT2G32030 122 / 2e-35 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10010569 [exp] 81 / 3e-20 AT3G22560 144 / 7e-44 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10032323 [exp] 77 / 2e-18 AT2G32030 107 / 6e-29 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Lus10007013 [exp] 78 / 6e-18 AT5G64300 506 / 4e-174 RED FLUORESCENT IN DARKNESS 1, Arabidopsis thaliana riboflavin A1, ARABIDOPSIS THALIANA GTP CYCLOHYDROLASE II, GTP cyclohydrolase II (.1) Lus10039346 [exp] 74 / 6e-18 AT2G32030 116 / 6e-34 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G154800 [exp] 153 / 7e-49 AT3G22560 225 / 3e-76 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.008G154700 [exp] 118 / 8e-35 AT3G22560 177 / 3e-57 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.010G085600 [exp] 92 / 1e-24 AT2G32030 223 / 6e-75 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1) Potri.007G102900 [exp] 91 / 2e-24 AT3G22560 96 / 9e-26 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041199 pacid=23179731 polypeptide=Lus10041199 locus=Lus10041199.g ID=Lus10041199.BGIv1.0 annot-version=v1.0 ATGACCGCTCAATATGGGCACCTCTCGATTTTCCCTGGGTCGGGCGACGATCGGAGCCGGGCGAACGCTGGGTATGCTCTGGCGCTGGAGTACTGGGGGC AGGGGATCGTCACGGCCGCCGTGAGGATGGCCATGTCCGCCGTTTTTAAGGACCTTCCGGAGATCGTGAGGCTTCAGGCGCTGGTGGAAGTGGAAAACAG AGGTTGTCAGAGGGTGCTGGAAAAAGTTGGGTTCTTGAAGGAAGGCCTGCTGAGGAAATATGGGTACAACAAAGGTGAGATTAGGGTTTTTATCGTTTAC AGCTTTTTGTTGGACTGA
AA sequence Show only first row Show all	>Lus10041199 pacid=23179731 polypeptide=Lus10041199 locus=Lus10041199.g ID=Lus10041199.BGIv1.0 annot-version=v1.0 MTAQYGHLSIFPGSGDDRSRANAGYALALEYWGQGIVTAAVRMAMSAVFKDLPEIVRLQALVEVENRGCQRVLEKVGFLKEGLLRKYGYNKGEIRVFIVY SFLLD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G22560			Acyl-CoA N-acyltransferases (N...		Lus10041199 [exp]	0	1
AT3G04460		PEX12, ATPEX12,...	ABERRANT PEROXISOME MORPHOLOGY...		Lus10029610 [exp]	65.3	0.5569
AT2G34930			disease resistance family prot...		Lus10039529 [exp]	71.4	0.5102
AT5G25280			serine-rich protein-related (....		Lus10008808 [exp]	99.7	0.5610
AT4G01240			S-adenosyl-L-methionine-depend...		Lus10010138 [exp]	103.8	0.5645
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Lus10035692 [exp]	134.6	0.5566

Compare expression of checked genes

Lus10041199 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.