Lus10041230 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G59530 243 / 5e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06620 239 / 1e-78 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G04380 233 / 4e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G59540 231 / 2e-75 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G06650 228 / 8e-74 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT1G04350 225 / 7e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G43450 222 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G06640 222 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT5G43440 220 / 5e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT2G30840 216 / 2e-69 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021943 378 / 9e-133 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037796 296 / 1e-100 AT1G06620 442 / 4e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017080 294 / 5e-100 AT1G06620 440 / 3e-155 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10027585 275 / 3e-92 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022195 274 / 5e-92 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022415 265 / 2e-88 AT1G06620 432 / 6e-152 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022197 254 / 4e-84 AT1G06620 434 / 6e-153 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021203 251 / 4e-83 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10022196 250 / 1e-82 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G073166 273 / 1e-91 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073300 261 / 7e-87 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.010G073100 253 / 1e-83 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G073232 250 / 9e-83 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.008G165400 247 / 2e-81 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G156200 238 / 5e-78 AT1G06650 430 / 7e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.013G045000 228 / 5e-74 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G135800 196 / 4e-61 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G222300 195 / 5e-61 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G136000 191 / 2e-59 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10041230 pacid=23179526 polypeptide=Lus10041230 locus=Lus10041230.g ID=Lus10041230.BGIv1.0 annot-version=v1.0
ATGGCTCCTTCTCCTCCAACCCCTGAAGAATTGCCGGCCTGCTCCAGGCAGATTGTGATGGAGTACACTAAGGAATTGCTCAAATTGACAGAGCTCATCT
TTGAATTGCTTTCGGAAGCTTTGGGTTTGGACTGTAATTACTTGAAAGAAATAGGCTGTGCAAAAGGATTATACATGGCTTGCCATTATTATCCAGCTTG
CCCACAGCCAGAGCTTACTCTGGGATCAACCAAGCATACCGATTATGATTTCATCACCGTGTTATTACAAGATCATATCGGAGGGCTTCAGGTTTTTCAT
CGAAATCAGTGGATCGATGTGCCGCCGTTGCCAAATAATCTAGTGATCAACATCGGAGACCTTCTTCAGCTGATATCGAACGACAAGTTTAAAAGTGTCG
AGCACAGGGTGGTGGCGAAGAATGTCGGGCCAAGGGTGTCTGTTGCATCATTTCTCACTACAGGGTTTACATCTAATGCGAGAGTTTATGGCCCTATAGA
AGAGTTGTTGTCCGTCGATAGTCCTCCGAAATATAGAGAAACAACAATCCTAGATTTCACTAGCCAGTTCTACAAAAAGGGTTTAGATGGTAACTCGGCT
CTGTTGTACTTCAAAATTATGTCTGCAAAGGGAATAAATTGA
AA sequence
>Lus10041230 pacid=23179526 polypeptide=Lus10041230 locus=Lus10041230.g ID=Lus10041230.BGIv1.0 annot-version=v1.0
MAPSPPTPEELPACSRQIVMEYTKELLKLTELIFELLSEALGLDCNYLKEIGCAKGLYMACHYYPACPQPELTLGSTKHTDYDFITVLLQDHIGGLQVFH
RNQWIDVPPLPNNLVINIGDLLQLISNDKFKSVEHRVVAKNVGPRVSVASFLTTGFTSNARVYGPIEELLSVDSPPKYRETTILDFTSQFYKKGLDGNSA
LLYFKIMSAKGIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G59530 2-oxoglutarate (2OG) and Fe(II... Lus10041230 0 1
AT3G56380 ARR17 response regulator 17 (.1) Lus10029027 15.7 0.6850
AT5G66930 unknown protein Lus10000838 101.0 0.6578
AT3G11320 Nucleotide-sugar transporter f... Lus10040710 118.6 0.6437
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011980 149.4 0.6471
AT5G23750 Remorin family protein (.1.2) Lus10024514 166.2 0.6338
AT5G26250 Major facilitator superfamily ... Lus10010532 189.4 0.6457

Lus10041230 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.