Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21550 241 / 7e-82 AtDMP2 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) AT3G21520 179 / 4e-57 AtDMP1 Arabidopsis thaliana DUF679 domain membrane protein 1, DUF679 domain membrane protein 1 (.1) AT5G46090 151 / 5e-46 Protein of unknown function (DUF679) (.1) AT4G18425 145 / 4e-44 Protein of unknown function (DUF679) (.1) AT3G02430 142 / 2e-42 Protein of unknown function (DUF679) (.1) AT4G24310 139 / 1e-41 Protein of unknown function (DUF679) (.1) AT1G09157 114 / 2e-31 Protein of unknown function (DUF679) (.1) AT5G39650 108 / 5e-29 DAU2 DUO1-activated unknown 2, Protein of unknown function (DUF679) (.1) AT5G27370 101 / 4e-27 Protein of unknown function (DUF679) (.1) AT4G28485 0 / 1 AtDMP7 Arabidopsis thaliana DUF679 domain membrane protein 7, DUF679 domain membrane protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021955 [exp] 367 / 2e-131 AT3G21550 237 / 3e-80 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Lus10015396 [exp] 158 / 1e-48 AT5G46090 239 / 3e-80 Protein of unknown function (DUF679) (.1) Lus10013971 [exp] 155 / 2e-47 AT5G46090 234 / 2e-78 Protein of unknown function (DUF679) (.1) Lus10013975 [exp] 153 / 2e-46 AT4G18425 257 / 3e-87 Protein of unknown function (DUF679) (.1) Lus10015394 [exp] 151 / 9e-46 AT4G18425 273 / 1e-93 Protein of unknown function (DUF679) (.1) Lus10013969 [exp] 150 / 1e-45 AT4G18425 274 / 5e-94 Protein of unknown function (DUF679) (.1) Lus10018635 [exp] 143 / 7e-43 AT5G46090 192 / 8e-62 Protein of unknown function (DUF679) (.1) Lus10013974 [exp] 143 / 1e-42 AT4G18425 238 / 1e-79 Protein of unknown function (DUF679) (.1) Lus10036581 [exp] 142 / 2e-42 AT3G02430 255 / 1e-86 Protein of unknown function (DUF679) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G027600 [exp] 249 / 6e-85 AT3G21550 202 / 1e-66 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Potri.008G115100 [exp] 234 / 6e-79 AT3G21550 213 / 9e-71 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Potri.011G058000 [exp] 152 / 9e-47 AT4G18425 247 / 8e-84 Protein of unknown function (DUF679) (.1) Potri.004G049000 [exp] 151 / 5e-46 AT4G18425 276 / 6e-95 Protein of unknown function (DUF679) (.1) Potri.017G016300 [exp] 149 / 1e-45 AT4G18425 203 / 2e-66 Protein of unknown function (DUF679) (.1) Potri.003G008600 [exp] 143 / 1e-42 AT3G02430 185 / 6e-59 Protein of unknown function (DUF679) (.1) Potri.013G116300 [exp] 130 / 3e-38 AT3G02430 94 / 9e-24 Protein of unknown function (DUF679) (.1) Potri.004G223500 [exp] 131 / 4e-38 AT3G02430 195 / 1e-62 Protein of unknown function (DUF679) (.1) Potri.013G027200 [exp] 119 / 1e-33 AT5G27370 153 / 5e-47 Protein of unknown function (DUF679) (.1) Potri.010G168400 [exp] 116 / 2e-32 AT1G09157 223 / 2e-73 Protein of unknown function (DUF679) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05078 [flax] [poplar] DUF679 Protein of unknown function (DUF679)
Representative CDS sequence Show only first row Show all	>Lus10041247 pacid=23179637 polypeptide=Lus10041247 locus=Lus10041247.g ID=Lus10041247.BGIv1.0 annot-version=v1.0 ATGGCGGAAACAGGTCTAATTTCCTCTTCAGGATCGCCGCGGAAGCTCCGATCGATGCAGGAAATGACATTTTCAGGGATAGGGAACATGATCAAGATGC TCCCGACGGGAACGGTGTTCATGTTCCAGTTCCTGAACCCTGTCCTGACCAACAACGGGAAATGCCAGACAGTCAACAAGTACCTGAGCGGGGCCCTGTT GACCGTCTGCGCTTTCAACTGCTGCTTCACTTCCTTCACCGACAGCTACGTGGACCCTGACGGCGGGGTCCACTACGGTATCGCGACTTTCAAGGGCTTC TGGCCTAAGCCTTCTTCTTCAGGTGACTGGTCGGGTTACCGGGTAAGGGTGGGGGACTTCTTCCACGCGTTACTTTCGCTGATCGTGTTTGCGGCTGTGT CGCTGTTGGACACCAATACGGTGTCGTGCTTCTACCCCGGGTTCGAATCCAGCGGGAAAGTGCTGCTCATGTCTCTGCCGCCGGTGATTGGACTGGTTTC GAGTGTCGTGTTTGCGATTTTCCCTAACGATCGCCATGGAATCGGGTACCCGCCCGCGAGTGGTCAGGATGCGTCCAAGACGTCGTGA
AA sequence Show only first row Show all	>Lus10041247 pacid=23179637 polypeptide=Lus10041247 locus=Lus10041247.g ID=Lus10041247.BGIv1.0 annot-version=v1.0 MAETGLISSSGSPRKLRSMQEMTFSGIGNMIKMLPTGTVFMFQFLNPVLTNNGKCQTVNKYLSGALLTVCAFNCCFTSFTDSYVDPDGGVHYGIATFKGF WPKPSSSGDWSGYRVRVGDFFHALLSLIVFAAVSLLDTNTVSCFYPGFESSGKVLLMSLPPVIGLVSSVVFAIFPNDRHGIGYPPASGQDASKTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G21550		AtDMP2	Arabidopsis thaliana DUF679 do...		Lus10041247 [exp]	0	1
					Lus10006423 [exp]	1.4	0.9791
AT5G04200		AtMCP2f, ATMC9	metacaspase 2f, metacaspase 9 ...		Lus10012106 [exp]	1.7	0.9762
AT5G04010			F-box family protein (.1)		Lus10035421 [exp]	2.8	0.9750
AT4G32810		MAX4, CCD8, ATC...	MORE AXILLARY BRANCHING 4, car...		Lus10038721 [exp]	3.5	0.9673
AT4G32810		MAX4, CCD8, ATC...	MORE AXILLARY BRANCHING 4, car...		Lus10001599 [exp]	3.6	0.9653
AT2G35930		PUB23	plant U-box 23 (.1)		Lus10021267 [exp]	3.7	0.9735
AT4G18550		AtDSEL	Arabidopsis thaliana DAD1-like...		Lus10013932 [exp]	4.2	0.9735
AT5G03260		LAC11	laccase 11 (.1)		Lus10002227 [exp]	4.2	0.9765
AT2G28500	AS2	LBD11	LOB domain-containing protein ...		Lus10040373 [exp]	6.9	0.9360
AT1G70500			Pectin lyase-like superfamily ...		Lus10030888 [exp]	7.1	0.9741

Compare expression of checked genes

Lus10041247 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.