Lus10041251 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021957 124 / 1e-35 AT2G39040 114 / 2e-29 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G015100 47 / 3e-07 ND /
PFAM info
Representative CDS sequence
>Lus10041251 pacid=23180003 polypeptide=Lus10041251 locus=Lus10041251.g ID=Lus10041251.BGIv1.0 annot-version=v1.0
ATGGACGTCTCTTGCTTTCTTCTTGTGGAGGGAAGTGCAGATTCTGACGAGGATCATGATCAGTACCACCATCACCGTCATCATGGATTAATGAAGAAAT
CATCATGTGATCATCATTGTGGTAATTACGATGAAGATCGGAAACATGATCAGCTGGAGGGAACAAATGATGTTGTGATTGATGATGCGGAGTCTTGTAG
CTGCGACGAGCCAGAGCTCGACCACCTTCTCTTCCTTCTCAGCCATCATCATCAAGCTGCTTCTTGCCATGACGATGAAGATGACGTTGCTGTTATTGAT
GAAGAGGAACCGTCACCACCGAGTAGCGTCAATATTAATGGAGAGGAGAATTATGACAGTAAGTTGAGGATAAGCAGAGAGATTATGGATAGAATGGAGG
ATAGTGTGTTCTGGGAAACATGTATGGCTGTAGGCTACCCAAGCCTGTACTGA
AA sequence
>Lus10041251 pacid=23180003 polypeptide=Lus10041251 locus=Lus10041251.g ID=Lus10041251.BGIv1.0 annot-version=v1.0
MDVSCFLLVEGSADSDEDHDQYHHHRHHGLMKKSSCDHHCGNYDEDRKHDQLEGTNDVVIDDAESCSCDEPELDHLLFLLSHHHQAASCHDDEDDVAVID
EEEPSPPSSVNINGEENYDSKLRISREIMDRMEDSVFWETCMAVGYPSLY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041251 0 1
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Lus10035975 1.0 0.9825
AT3G54450 Major facilitator superfamily ... Lus10039521 2.4 0.9760
AT4G24910 Protein of unknown function (D... Lus10002345 2.4 0.9794
AT2G37870 Bifunctional inhibitor/lipid-t... Lus10031925 3.5 0.9742
AT5G17390 Adenine nucleotide alpha hydro... Lus10034661 3.5 0.9703
AT4G24910 Protein of unknown function (D... Lus10003160 5.5 0.9733
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Lus10007907 5.5 0.9589
AT4G09890 Protein of unknown function (D... Lus10028734 6.6 0.9341
AT2G37900 Major facilitator superfamily ... Lus10012663 6.7 0.9609
AT4G23610 Late embryogenesis abundant (L... Lus10027179 7.0 0.9653

Lus10041251 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.