Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53708 69 / 4e-17 RTFL9 ROTUNDIFOLIA like 9 (.1) AT3G14362 65 / 4e-16 DVL19, RTFL10 DEVIL 19, ROTUNDIFOLIA like 10 (.1) AT3G55515 53 / 3e-11 DVL8, RTFL7 DEVIL 8, ROTUNDIFOLIA like 7 (.1) AT2G39705 51 / 2e-10 RTFL8, DVL11 DEVIL 11, ROTUNDIFOLIA like 8 (.1) AT4G13395 49 / 1e-09 DVL10, RTFL12 DEVIL 10, ROTUNDIFOLIA like 12 (.1) AT2G36985 48 / 2e-09 DVL16, ROT4 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) AT5G59510 47 / 2e-08 RTFL5, DVL18 DEVIL 18, ROTUNDIFOLIA like 5 (.1) AT1G68825 44 / 6e-08 DVL5, RTFL15 DEVIL 5, ROTUNDIFOLIA like 15 (.1.2) AT2G29125 44 / 3e-07 RTFL2, DVL13 DEVIL 13, ROTUNDIFOLIA like 2 (.1) AT1G07490 43 / 4e-07 RTFL3, DVL9 DEVIL 9, ROTUNDIFOLIA like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021966 [exp] 117 / 1e-36 AT1G53708 73 / 8e-19 ROTUNDIFOLIA like 9 (.1) Lus10002705 [exp] 57 / 2e-12 AT2G39705 86 / 1e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10023399 [exp] 51 / 3e-10 AT2G39705 91 / 3e-25 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Lus10040784 [exp] 49 / 3e-09 AT5G59510 84 / 1e-21 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10028393 [exp] 47 / 6e-09 AT4G35783 60 / 5e-14 DEVIL 17, ROTUNDIFOLIA like 6 (.1) Lus10001569 [exp] 44 / 2e-07 AT5G59510 79 / 8e-20 DEVIL 18, ROTUNDIFOLIA like 5 (.1) Lus10034272 [exp] 43 / 2e-07 AT1G13245 72 / 5e-19 DEVIL 4, ROTUNDIFOLIA like 17 (.1) Lus10026526 [exp] 42 / 5e-07 AT2G36985 63 / 2e-15 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Lus10041491 [exp] 40 / 2e-06 AT1G13245 66 / 1e-16 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G235101 [exp] 83 / 2e-23 AT1G53708 75 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.003G073900 [exp] 81 / 3e-22 AT1G53708 81 / 9e-22 ROTUNDIFOLIA like 9 (.1) Potri.001G161200 [exp] 73 / 3e-19 AT1G53708 76 / 1e-19 ROTUNDIFOLIA like 9 (.1) Potri.008G057800 [exp] 53 / 3e-11 AT2G39705 84 / 8e-23 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.010G226250 [exp] 52 / 4e-11 AT2G36985 67 / 3e-17 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.008G035900 [exp] 52 / 4e-11 AT2G36985 66 / 1e-16 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G201700 [exp] 52 / 7e-11 AT2G39705 72 / 2e-18 DEVIL 11, ROTUNDIFOLIA like 8 (.1) Potri.001G242800 [exp] 49 / 1e-09 AT2G29125 71 / 4e-17 DEVIL 13, ROTUNDIFOLIA like 2 (.1) Potri.006G125600 [exp] 45 / 3e-08 AT2G36985 75 / 3e-20 ROTUNDIFOLIA4, DEVIL 16, DVL family protein (.1) Potri.010G129600 [exp] 42 / 3e-07 AT1G13245 75 / 1e-20 DEVIL 4, ROTUNDIFOLIA like 17 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08137 [flax] [poplar] DVL DVL family
Representative CDS sequence Show only first row Show all	>Lus10041259 pacid=23179853 polypeptide=Lus10041259 locus=Lus10041259.g ID=Lus10041259.BGIv1.0 annot-version=v1.0 ATGGCTGAGATCACTGTATACTCCAGGAATGCCTCTACTGCTGCTGCACCACACAGCAAAAAGGGTCGTCGCTTCACCAGGAAATGTGCATCCTTGATTC AGGAGCAGCGTTCCAGGATTTATGTCCTGCGCCGTTGCGCCACCATGCTCCTTTGCTGGTATATTCAGGATGATGACTGA
AA sequence Show only first row Show all	>Lus10041259 pacid=23179853 polypeptide=Lus10041259 locus=Lus10041259.g ID=Lus10041259.BGIv1.0 annot-version=v1.0 MAEITVYSRNASTAAAPHSKKGRRFTRKCASLIQEQRSRIYVLRRCATMLLCWYIQDDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Lus10041259 [exp]	0	1
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Lus10034544 [exp]	1.0	0.8363
AT5G65030			unknown protein		Lus10014340 [exp]	4.2	0.7766
AT1G53708		RTFL9	ROTUNDIFOLIA like 9 (.1)		Lus10021966 [exp]	4.2	0.6735
AT3G62100	AUX_IAA	IAA30	indole-3-acetic acid inducible...		Lus10007193 [exp]	4.6	0.6884
AT5G10970	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10017125 [exp]	12.4	0.6948
AT3G20750	GATA	GATA29	GATA transcription factor 29 (...		Lus10042504 [exp]	14.3	0.6960
AT3G19940			Major facilitator superfamily ...		Lus10028729 [exp]	16.6	0.7029
AT3G25280			Major facilitator superfamily ...		Lus10025881 [exp]	17.2	0.6790
AT3G63095			Tetratricopeptide repeat (TPR)...		Lus10028014 [exp]	20.6	0.5866
AT2G46150			Late embryogenesis abundant (L...		Lus10027178 [exp]	27.9	0.6594

Compare expression of checked genes

Lus10041259 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.