Lus10041264 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G05590 288 / 8e-101 RPL18 ribosomal protein L18 (.1)
AT5G27850 287 / 2e-100 Ribosomal protein L18e/L15 superfamily protein (.1)
AT2G47570 202 / 2e-67 Ribosomal protein L18e/L15 superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029879 322 / 5e-114 AT5G27850 330 / 3e-117 Ribosomal protein L18e/L15 superfamily protein (.1)
Lus10015198 314 / 1e-110 AT3G05590 333 / 2e-118 ribosomal protein L18 (.1)
Lus10031485 315 / 7e-109 AT3G05590 333 / 9e-116 ribosomal protein L18 (.1)
Lus10020659 316 / 2e-107 AT3G05580 562 / 0.0 type one protein phosphatase 9, Calcineurin-like metallo-phosphoesterase superfamily protein (.1)
Lus10021971 316 / 1e-105 AT5G42390 629 / 0.0 stromal processing peptidase, Insulinase (Peptidase family M16) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G202800 307 / 3e-108 AT3G05590 340 / 3e-121 ribosomal protein L18 (.1)
Potri.014G127300 306 / 5e-108 AT3G05590 334 / 8e-119 ribosomal protein L18 (.1)
Potri.013G013600 303 / 2e-106 AT3G05590 337 / 8e-120 ribosomal protein L18 (.1)
Potri.005G023500 299 / 4e-105 AT3G05590 320 / 2e-113 ribosomal protein L18 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0588 Ribos_L15p_L18e PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Representative CDS sequence
>Lus10041264 pacid=23179959 polypeptide=Lus10041264 locus=Lus10041264.g ID=Lus10041264.BGIv1.0 annot-version=v1.0
ATGGGGATCGATTTGAAGGCAGGAGGTAAGAGGAAGAAGACGAAGCGTACGGCACCGAAGTCCAATGATATCTACCTTAAGCTCCTTGTGAAGCTTTACC
GGTTTCTGGTGAGGAGAACTGGAAGCAGCTTCAATGCTGTGATATTGAAAAGGCTGTTCATGAGCAAGGTTAACAAGCCGCCACTATCTCTGTCCAGGCT
TATCCGCTTCACCAAGGGAAAGGAGGGAAAAATCGCAGTGGTTGTGGGAACAATCACGGATGACATTAGAGTTTATGATATTCCCGCTATGAAAGTAACT
GCCTTGAGGTTCACTGAGACTGCTAGGGCCAGAATCGAGAAGGCTGGTGGGGAGTGCTTGACCTTTGACCAGCTTGCTTTGAGGGCTCCTCTTGGCCAGA
ACACGGTTCTTCTCAGGGGTCCAAAGAATGCTCGTGAGGCAGTGAAGCATTTCGGCCCAGCACCTGGTGTGCCACACAGCCATACCAAGCCTTACGTTAG
GTCGAAGGGAAGGAAGTTTGAGAGGGCAAGAGGAAGGAGGAACAGCAGGGGATTCAGGGTTTAA
AA sequence
>Lus10041264 pacid=23179959 polypeptide=Lus10041264 locus=Lus10041264.g ID=Lus10041264.BGIv1.0 annot-version=v1.0
MGIDLKAGGKRKKTKRTAPKSNDIYLKLLVKLYRFLVRRTGSSFNAVILKRLFMSKVNKPPLSLSRLIRFTKGKEGKIAVVVGTITDDIRVYDIPAMKVT
ALRFTETARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPKNAREAVKHFGPAPGVPHSHTKPYVRSKGRKFERARGRRNSRGFRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G27850 Ribosomal protein L18e/L15 sup... Lus10041264 0 1
AT4G18100 Ribosomal protein L32e (.1) Lus10020410 1.0 0.9800
AT2G03590 ATUPS1 ureide permease 1 (.1) Lus10037074 2.0 0.9599
AT5G47680 AtTRM, TRM10 tRNA modification 10, unknown ... Lus10038778 2.8 0.9465
AT5G52370 unknown protein Lus10016449 3.5 0.9477
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10027260 4.6 0.9590
AT4G14320 Zinc-binding ribosomal protein... Lus10017396 4.6 0.9471
AT2G03510 SPFH/Band 7/PHB domain-contain... Lus10026664 5.5 0.9503
AT4G18100 Ribosomal protein L32e (.1) Lus10009591 6.3 0.9579
AT5G12110 Glutathione S-transferase, C-t... Lus10036101 9.2 0.9406
AT5G24510 60S acidic ribosomal protein f... Lus10008943 11.0 0.9266

Lus10041264 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.