Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023629 [exp] 78 / 6e-21 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10024263 [exp] 76 / 2e-20 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10037436 [exp] 74 / 2e-19 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078801 [exp] 64 / 2e-15 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [flax] [poplar] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Lus10041273 pacid=23179830 polypeptide=Lus10041273 locus=Lus10041273.g ID=Lus10041273.BGIv1.0 annot-version=v1.0 ATGAGTTCGATGAAAATGTACGCCGCTCCGATCATCGGGTTCCTGATTTTGGCGCTTACCGAGTTTGGTTATGGACAAGGCTTATCTCCTTCTCCTGCCG CGGAAGGTCCATCCAGCAATGACGGGGCGGCGATCGATCAAGGAATTGCTTACCTTCTTCTCTTGCTGGCGCTTGGCATCACATACCTCATCCATTGA
AA sequence Show only first row Show all	>Lus10041273 pacid=23179830 polypeptide=Lus10041273 locus=Lus10041273.g ID=Lus10041273.BGIv1.0 annot-version=v1.0 MSSMKMYAAPIIGFLILALTEFGYGQGLSPSPAAEGPSSNDGAAIDQGIAYLLLLLALGITYLIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Lus10041273 [exp]	0	1
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Lus10008066 [exp]	1.0	0.9657
AT5G25240			unknown protein		Lus10006290 [exp]	1.4	0.9601
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10013589 [exp]	6.0	0.9434
AT2G18210			unknown protein		Lus10041771 [exp]	9.8	0.9421
AT1G56300			Chaperone DnaJ-domain superfam...		Lus10029862 [exp]	13.9	0.9361
AT3G27320			alpha/beta-Hydrolases superfam...		Lus10036931 [exp]	16.0	0.9148
AT5G40010		ASD, AATP1	ATPase-in-Seed-Development, AA...		Lus10015349 [exp]	16.1	0.9210
AT2G37970		SOUL-1	SOUL heme-binding family prote...		Lus10027752 [exp]	17.7	0.9527
AT3G23250	MYB	ATMYB15, ATY19	myb domain protein 15 (.1.2)		Lus10041145 [exp]	18.3	0.9492
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10038524 [exp]	19.3	0.9340

Compare expression of checked genes

Lus10041273 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.