Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80320 54 / 6e-10 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52790 49 / 3e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G15540 47 / 1e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52800 46 / 2e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52820 45 / 7e-07 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 44 / 1e-06 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G28030 37 / 0.0003 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016659 [exp] 42 / 9e-06 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023024 [exp] 40 / 3e-05 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10005516 [exp] 40 / 3e-05 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023160 [exp] 38 / 0.0002 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10041281 [exp] 0 / 1 AT1G52790 298 / 5e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176100 [exp] 57 / 3e-11 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176200 [exp] 48 / 6e-08 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176500 [exp] 46 / 2e-07 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176000 [exp] 44 / 1e-06 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175800 [exp] 42 / 9e-06 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G175900 [exp] 42 / 1e-05 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.018G033400 [exp] 41 / 2e-05 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.006G248000 [exp] 38 / 0.0002 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041279 pacid=23179578 polypeptide=Lus10041279 locus=Lus10041279.g ID=Lus10041279.BGIv1.0 annot-version=v1.0 ATGACGACGACGGTGGTCGATGGGTTTGCTACCAGCCTGCATCTATGTCTTCGTTTCTTGTGCTCGCCGGTGATGCAATCATGGCATGGAGCAACGACAG AATCAAGTCTGTGTTACCATAGGGTGATGGTGAGCGGAGAAGAAGTGAGGTATGCAGTGGGAATGTTCACATTCCGAACTGGTGCCATTGAAGCCCCTGA AGAGCTTGTTGATGAAGAACAACACCAAGGATAA
AA sequence Show only first row Show all	>Lus10041279 pacid=23179578 polypeptide=Lus10041279 locus=Lus10041279.g ID=Lus10041279.BGIv1.0 annot-version=v1.0 MTTTVVDGFATSLHLCLRFLCSPVMQSWHGATTESSLCYHRVMVSGEEVRYAVGMFTFRTGAIEAPEELVDEEQHQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80320			2-oxoglutarate (2OG) and Fe(II...		Lus10041279 [exp]	0	1
AT4G08180		ORP1C	OSBP(oxysterol binding protein...		Lus10025695 [exp]	2.8	0.8624
AT4G17905		ATL4H	RING/U-box superfamily protein...		Lus10027736 [exp]	5.9	0.8925
AT4G27300			S-locus lectin protein kinase ...		Lus10038555 [exp]	6.3	0.8691
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10041280 [exp]	9.9	0.8647
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10033336 [exp]	11.7	0.8713
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10000992 [exp]	12.7	0.7984
AT3G47570			Leucine-rich repeat protein ki...		Lus10035726 [exp]	19.7	0.8114
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10032219 [exp]	22.1	0.8863
AT5G06760		AtLEA4-5, LEA4-...	Late Embryogenesis Abundant 4-...		Lus10012009 [exp]	22.8	0.8402
AT4G24000		ATCSLG2	ARABIDOPSIS THALIANA CELLULOSE...		Lus10032416 [exp]	23.0	0.8526

Compare expression of checked genes

Lus10041279 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.