Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52820 51 / 8e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G52800 40 / 8e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03070 39 / 0.0002 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G03050 39 / 0.0003 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037429 [exp] 61 / 7e-14 AT1G28030 41 / 9e-06 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G176100 [exp] 51 / 1e-08 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G176200 [exp] 41 / 5e-05 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041280 pacid=23179688 polypeptide=Lus10041280 locus=Lus10041280.g ID=Lus10041280.BGIv1.0 annot-version=v1.0 ATGGGTTCGGAAGAGACTACAGATTCCAGAATCCCAAAGGTTGATCTATCTGGAGAATCTCTGCTTACTGGATCCCCTGCTCTGCACTTAGATCAGAAGA GCCATGGAAGGCTACGGATGCCTCGAAATCGTGTACCACAACCATCACCTGAATTCCACAACTCCATTCTGGAATCACTGGAGCAACTGTTCAGCCTCCC ACAAGAAACCAAGATGAGGAACGTCAACCCAAAACCGGCTCACTGGCTACATGGGCAAACTATTTGTTCTCCCCATCCACGAAGGCCTCGAGATCGAGTA CGCAGACAATAG
AA sequence Show only first row Show all	>Lus10041280 pacid=23179688 polypeptide=Lus10041280 locus=Lus10041280.g ID=Lus10041280.BGIv1.0 annot-version=v1.0 MGSEETTDSRIPKVDLSGESLLTGSPALHLDQKSHGRLRMPRNRVPQPSPEFHNSILESLEQLFSLPQETKMRNVNPKPAHWLHGQTICSPHPRRPRDRV RRQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10041280 [exp]	0	1
AT5G10530			Concanavalin A-like lectin pro...		Lus10019234 [exp]	4.5	0.8716
AT2G42140			VQ motif-containing protein (....		Lus10004172 [exp]	5.0	0.8847
AT4G17905		ATL4H	RING/U-box superfamily protein...		Lus10027736 [exp]	6.0	0.8994
					Lus10004442 [exp]	6.9	0.9040
AT1G80320			2-oxoglutarate (2OG) and Fe(II...		Lus10041279 [exp]	9.9	0.8647
AT5G23950			Calcium-dependent lipid-bindin...		Lus10039259 [exp]	14.9	0.8825
AT3G47570			Leucine-rich repeat protein ki...		Lus10037310 [exp]	17.1	0.8875
AT5G59790			Domain of unknown function (DU...		Lus10003286 [exp]	20.0	0.8820
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10032219 [exp]	25.3	0.8865
AT1G51340			MATE efflux family protein (.1...		Lus10042365 [exp]	40.4	0.8646

Compare expression of checked genes

Lus10041280 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.