Lus10041281 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G52790 299 / 2e-102 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52800 205 / 2e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G80320 205 / 3e-65 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52820 191 / 5e-60 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G15540 180 / 2e-55 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03070 159 / 3e-47 AOP1.1, AOP1 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G28030 125 / 2e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G52810 105 / 7e-27 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G03050 94 / 6e-23 AOP3 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25420 82 / 4e-18 AT2301, GA5, ATGA20OX1 GA REQUIRING 5, ARABIDOPSIS THALIANA GIBBERELLIN 20-OXIDASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016659 200 / 2e-63 AT1G52820 445 / 1e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023024 179 / 3e-55 AT1G52820 371 / 2e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005773 154 / 2e-45 AT1G52790 205 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10021025 151 / 4e-44 AT1G52800 226 / 2e-72 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005776 144 / 2e-41 AT1G52790 198 / 2e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10023160 140 / 6e-41 AT1G52820 244 / 1e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10008097 135 / 5e-38 AT1G52800 221 / 2e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10006575 128 / 3e-36 AT1G52820 221 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005516 128 / 5e-35 AT1G52820 278 / 7e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G176000 323 / 1e-111 AT1G52790 460 / 2e-164 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176500 222 / 6e-72 AT1G52800 338 / 1e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176200 205 / 2e-65 AT1G52820 496 / 8e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G176100 200 / 1e-63 AT1G52800 286 / 5e-96 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G248000 168 / 2e-50 AT1G52820 280 / 6e-93 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.018G033400 166 / 2e-50 AT1G52820 269 / 4e-89 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175900 157 / 8e-47 AT1G52820 328 / 2e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G175800 157 / 1e-46 AT1G52820 338 / 2e-116 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.005G065400 79 / 5e-17 AT5G51810 402 / 8e-140 gibberellin 20 oxidase 2 (.1)
Potri.012G132400 78 / 1e-16 AT5G51810 522 / 0.0 gibberellin 20 oxidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10041281 pacid=23179572 polypeptide=Lus10041281 locus=Lus10041281.g ID=Lus10041281.BGIv1.0 annot-version=v1.0
ATGAAAAACAAGTATGAAGAGCCAGGGCACGGTTATGTGGGACAGATTGCCAAACTTCCTCTCCATGAAAGCATGGGCATCCACAATGCATCTCGATCCG
ATGCCATAGCTGATTTCACCGCTCTCATGTGGCCTCATCGCGGAAACCACTGCTTCAGGGAGAAAGTGGATAGATACGCGAAGCTAGCATCAGAGCTAGA
CAAAACAGTGACGAGGATGATATTCGAAAGCTACGGAATCGATCAGAAGCACCACGACGCCTACGTGGAGTCCACGAGCCATCTACTCCGGCCGCTGAAG
AACAGAGCTCCGGTCGGAGACGAACCTCATTTGGGGTTCGTCAGTCACACCGACAAGAGTTTCACTACCATACTCCATCAGAACCAGGTAGAGGGTCTGG
AGATCTACGCCGTTAATAACATCAACGGCTGTAACAAGATCAGCGTCACATTTTCATCCCCGGCTTCGTTCGTGGTCGTAGCCGGAGATGCCTTGATGGC
GTGGAGCAACGACAGGATAATTTCTCCGACGCACAGAGTGATAATGAACGGGGAAGTGGACAGATACTCGATGGGGCTGTTCGGGTTCAGCAAAGGGATG
ATTCAAGTGCCTCAAGAGTTTGTTGATGAACAGCATCCGTTGAGGTACATGCCGTTCGATCATCTTGGACTGCTTCGCTTCTTCCGTACTGAGGAAGGTT
GCAAGTCCTAG
AA sequence
>Lus10041281 pacid=23179572 polypeptide=Lus10041281 locus=Lus10041281.g ID=Lus10041281.BGIv1.0 annot-version=v1.0
MKNKYEEPGHGYVGQIAKLPLHESMGIHNASRSDAIADFTALMWPHRGNHCFREKVDRYAKLASELDKTVTRMIFESYGIDQKHHDAYVESTSHLLRPLK
NRAPVGDEPHLGFVSHTDKSFTTILHQNQVEGLEIYAVNNINGCNKISVTFSSPASFVVVAGDALMAWSNDRIISPTHRVIMNGEVDRYSMGLFGFSKGM
IQVPQEFVDEQHPLRYMPFDHLGLLRFFRTEEGCKS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G52790 2-oxoglutarate (2OG) and Fe(II... Lus10041281 0 1
AT1G05850 CTL1, HOT2, ERH... POM-POM1, SENSITIVE TO HOT TEM... Lus10041283 5.0 0.8176
AT2G22730 Major facilitator superfamily ... Lus10003528 11.4 0.8700
AT1G71010 FAB1C FORMS APLOID AND BINUCLEATE CE... Lus10016702 16.3 0.8209
AT1G22930 T-complex protein 11 (.1.2) Lus10001363 18.0 0.8368
AT1G54610 Protein kinase superfamily pro... Lus10001715 21.0 0.8676
AT3G20860 ATNEK5 NIMA-related kinase 5 (.1) Lus10040499 24.0 0.8686
AT5G07270 XBAT33 XB3 ortholog 3 in Arabidopsis ... Lus10005754 29.0 0.8367
AT4G28260 unknown protein Lus10018587 33.5 0.8428
AT1G48790 AMSH1 associated molecule with the S... Lus10009634 33.6 0.8457
AT1G22930 T-complex protein 11 (.1.2) Lus10015468 39.6 0.8253

Lus10041281 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.