Lus10041297 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09310 187 / 2e-62 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037415 235 / 5e-81 AT5G09310 190 / 3e-63 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G063100 213 / 2e-72 AT5G09310 189 / 7e-63 unknown protein
Potri.007G106200 108 / 7e-32 AT5G09310 104 / 2e-30 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10251 PEN-2 Presenilin enhancer-2 subunit of gamma secretase
Representative CDS sequence
>Lus10041297 pacid=23179724 polypeptide=Lus10041297 locus=Lus10041297.g ID=Lus10041297.BGIv1.0 annot-version=v1.0
ATGGAACCCTCACACCCTAACTCCTCTGTGTCCTCTTCTTCCACCACAAATCCCACACCGATCCCCAACTCCATACTCGCGTCGGTGCCTGTGTGGCCCA
CCATCGACGGTCCACTAGGTCTGACGGAGGATGAATCGTTGACCTACGCCCGTCGCTTCTACGGCTTCGGCTACGCCCTCCTTCCGTGGCTTTGGGCAGT
GAATTGCTTCTACTTCTGGCCCGTCCTCCGCCATTCCCGCTCTTTCCCCCTCATTCGCCCCTATGTTATGAAGTCGGCTATTGGATTCTGGGTATTCACA
AGTGTCCTCTGTTCGTGGGCATTCACATTTGCCATCGGCGGGGAGCAGCTGTTCGGCCCTGTCTGGGATAAACTAGTGATGTATAATCTTGCTGATAGGT
TAGGGTTGACAGGTTGGATCTAG
AA sequence
>Lus10041297 pacid=23179724 polypeptide=Lus10041297 locus=Lus10041297.g ID=Lus10041297.BGIv1.0 annot-version=v1.0
MEPSHPNSSVSSSSTTNPTPIPNSILASVPVWPTIDGPLGLTEDESLTYARRFYGFGYALLPWLWAVNCFYFWPVLRHSRSFPLIRPYVMKSAIGFWVFT
SVLCSWAFTFAIGGEQLFGPVWDKLVMYNLADRLGLTGWI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09310 unknown protein Lus10041297 0 1
AT5G65630 GTE7 global transcription factor gr... Lus10010525 1.4 0.7621
AT5G16380 Protein of unknown function, D... Lus10026841 2.0 0.7392
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10020390 4.2 0.7357
AT3G53810 Concanavalin A-like lectin pro... Lus10001562 4.6 0.7180
AT3G53390 Transducin/WD40 repeat-like su... Lus10000150 8.9 0.7018
Lus10038255 17.3 0.7201
AT2G28105 unknown protein Lus10016142 18.2 0.6567
AT1G03440 Leucine-rich repeat (LRR) fami... Lus10029622 20.2 0.7217
AT5G66650 Protein of unknown function (D... Lus10005312 21.4 0.6750
AT5G06900 CYP93D1 "cytochrome P450, family 93, s... Lus10035502 25.3 0.6830

Lus10041297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.