Lus10041308 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G60670 305 / 5e-108 Ribosomal protein L11 family protein (.1)
AT2G37190 301 / 2e-106 Ribosomal protein L11 family protein (.1)
AT3G53430 301 / 3e-106 Ribosomal protein L11 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037402 325 / 6e-116 AT5G60670 300 / 4e-106 Ribosomal protein L11 family protein (.1)
Lus10023186 320 / 6e-114 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10026506 320 / 6e-114 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10019935 320 / 6e-114 AT5G60670 309 / 1e-109 Ribosomal protein L11 family protein (.1)
Lus10015086 139 / 2e-43 AT3G53430 134 / 5e-42 Ribosomal protein L11 family protein (.1)
Lus10015085 97 / 2e-27 AT5G60670 95 / 4e-27 Ribosomal protein L11 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G145506 310 / 4e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145504 310 / 4e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G146600 310 / 4e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.018G145200 310 / 4e-110 AT2G37190 299 / 1e-105 Ribosomal protein L11 family protein (.1)
Potri.006G077200 308 / 3e-109 AT2G37190 295 / 7e-104 Ribosomal protein L11 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03946 Ribosomal_L11_N Ribosomal protein L11, N-terminal domain
PF00298 Ribosomal_L11 Ribosomal protein L11, RNA binding domain
Representative CDS sequence
>Lus10041308 pacid=23179906 polypeptide=Lus10041308 locus=Lus10041308.g ID=Lus10041308.BGIv1.0 annot-version=v1.0
ATGCCGCCCAAATTCGACCCATCCCAGGTCGTCGACGTCTTCGTCCGCGTCACCGGCGGCGAAGTAGGTGCGGCCAGTTCCCTCGCCCCGAAGATCGGTC
CTCTCGGTCTGTCTCCGAAGAAAATCGGAGAAGACATCGCGAAGGAGACTACCAAGGAATGGAAGGGCCTCCGCGTAACAGTCAAGCTCACCGTACAGAA
TCGTCAGGCGAAGGTCACCGTTGTTCCGTCTGCCGCCGCTCTGGTCATCAAGGCCCTGAAGGAGCCAGAGAGGGACAGGAAGAAGACCAAGAATATCAAG
CACAACGGAAACATTTCCCTCGACGACGTCATCGAGATCGCCAAGGTGATGAAGCCCAGGTCAATGGCTAAGGATCTCAGCGGCACGATTAAGGAGATTC
TGGGTACTTGCGTATCGGTTGGGTGCACCGTTGATGGAAAGGATCCCAAGGACTTGCAGCAGGAGATTAATGATGGCGATGTCGAGGTGCCGCTTGAATG
A
AA sequence
>Lus10041308 pacid=23179906 polypeptide=Lus10041308 locus=Lus10041308.g ID=Lus10041308.BGIv1.0 annot-version=v1.0
MPPKFDPSQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETTKEWKGLRVTVKLTVQNRQAKVTVVPSAAALVIKALKEPERDRKKTKNIK
HNGNISLDDVIEIAKVMKPRSMAKDLSGTIKEILGTCVSVGCTVDGKDPKDLQQEINDGDVEVPLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G60670 Ribosomal protein L11 family p... Lus10041308 0 1
AT5G18380 Ribosomal protein S5 domain 2-... Lus10034378 4.2 0.9393
AT1G20300 Pentatricopeptide repeat (PPR)... Lus10011459 4.2 0.9332
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10015588 4.4 0.9583
AT5G05520 Outer membrane OMP85 family pr... Lus10017441 4.9 0.9444
AT3G04770 RPSAB 40s ribosomal protein SA B (.1... Lus10037445 5.3 0.9564
AT3G49240 EMB1796 embryo defective 1796, Pentatr... Lus10018109 5.4 0.9202
AT3G49910 Translation protein SH3-like f... Lus10019283 7.0 0.9416
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Lus10032962 7.7 0.9367
AT5G44500 Small nuclear ribonucleoprotei... Lus10023386 8.0 0.9348
AT3G49910 Translation protein SH3-like f... Lus10018139 8.1 0.9531

Lus10041308 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.