Lus10041330 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041330 pacid=23179757 polypeptide=Lus10041330 locus=Lus10041330.g ID=Lus10041330.BGIv1.0 annot-version=v1.0
ATGGGTGCATGGTGGTGGCCACAGTATAATTTGGCTTGGCATCGATCTCCAGGTAGGTTGGCTCTCTCATCTCAGCAGTCGTCGTCTGGCTCAGTCTGTG
CCCTCCCTCTGAACATCACTGCATGCGGCTGGCTCTTATTCCGGTCCACTGCCCTATTTGTCCCGCCTTGTTTTCCAATAATGGCAATTTGTGGTGATGA
AGAGCAGGCAAGTGGTTGGAATTGCGACCGCATCCCTCCCGGCGCTGACTTCTGGCTTGATTTGTGA
AA sequence
>Lus10041330 pacid=23179757 polypeptide=Lus10041330 locus=Lus10041330.g ID=Lus10041330.BGIv1.0 annot-version=v1.0
MGAWWWPQYNLAWHRSPGRLALSSQQSSSGSVCALPLNITACGWLLFRSTALFVPPCFPIMAICGDEEQASGWNCDRIPPGADFWLDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041330 0 1
Lus10028091 6.3 0.6764
AT1G69320 CLE10 CLAVATA3/ESR-RELATED 10 (.1) Lus10036960 6.8 0.7259
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Lus10041344 7.5 0.7132
Lus10038720 14.1 0.6870
Lus10022109 14.9 0.6757
AT2G02070 C2H2ZnF ATIDD5 indeterminate(ID)-domain 5 (.1... Lus10035092 15.9 0.6457
AT4G08850 Leucine-rich repeat receptor-l... Lus10005015 18.3 0.6147
Lus10030775 21.6 0.6900
AT4G24140 BDG3 alpha/beta-Hydrolases superfam... Lus10008266 24.8 0.6749
AT1G73965 CLE13 CLAVATA3/ESR-RELATED 13 (.1) Lus10037107 25.5 0.6107

Lus10041330 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.