Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G45050 128 / 6e-39 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G008400 [exp] 134 / 2e-41 AT3G45050 80 / 2e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041331 pacid=23179937 polypeptide=Lus10041331 locus=Lus10041331.g ID=Lus10041331.BGIv1.0 annot-version=v1.0 ATGAACATAGTGAATCGGAGCAGAAGACCACCAATCGTTGTGCCCCATGGTCTTGTCGAAACGGCTGCTTCTGTAGCAATTGCTGCCACGGTTGTAGGTG GGGCTGCTACCTTACTTGTTAATAGAAGCAAAGCTACTGAGGCAAAGGATCAGGTTCAATTGAAAACATGTGAAGAATGTGGTGGCTCTGGGATATGCCC AGAATGCAAAGGGGAAGGCTTTGTGCTGAAGAGGCTGTCAGATGAAAGTGCTGATAAAGCAAGGAAGAGTGCAAAGAATATGGCCACTAGATATACAGCA GGGCTTCCCAAGAAATGGAGCTATTGTAACAAGTGCTCTGCTTCCAGATCCTGCACCACCTGCGATGGCCGTGGCAAATTAAGCTTCTAA
AA sequence Show only first row Show all	>Lus10041331 pacid=23179937 polypeptide=Lus10041331 locus=Lus10041331.g ID=Lus10041331.BGIv1.0 annot-version=v1.0 MNIVNRSRRPPIVVPHGLVETAASVAIAATVVGGAATLLVNRSKATEAKDQVQLKTCEECGGSGICPECKGEGFVLKRLSDESADKARKSAKNMATRYTA GLPKKWSYCNKCSASRSCTTCDGRGKLSF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G45050			unknown protein		Lus10041331 [exp]	0	1
AT5G53490			Tetratricopeptide repeat (TPR)...		Lus10007788 [exp]	1.0	0.9701
AT4G23890		NdhS, CRR31	NADH dehydrogenase-like comple...		Lus10001826 [exp]	1.4	0.9699
AT5G62960			unknown protein		Lus10039964 [exp]	1.7	0.9630
AT1G54500			Rubredoxin-like superfamily pr...		Lus10015945 [exp]	2.8	0.9529
AT4G17560			Ribosomal protein L19 family p...		Lus10014467 [exp]	3.5	0.9519
AT4G25080		CHLM	magnesium-protoporphyrin IX me...		Lus10016730 [exp]	3.9	0.9522
AT5G42765			unknown protein		Lus10032714 [exp]	4.7	0.9484
AT1G07700			Thioredoxin superfamily protei...		Lus10024726 [exp]	6.0	0.9490
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Lus10031342 [exp]	6.8	0.9338
AT4G09010		TL29, APX4	thylakoid lumen 29, ascorbate ...		Lus10008718 [exp]	7.2	0.9436

Compare expression of checked genes

Lus10041331 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.