Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G28085 68 / 5e-16 SAUR-like auxin-responsive protein family (.1) AT3G09870 54 / 1e-10 SAUR-like auxin-responsive protein family (.1) AT4G38860 52 / 4e-10 SAUR-like auxin-responsive protein family (.1) AT5G53590 51 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT1G19830 50 / 4e-09 SAUR-like auxin-responsive protein family (.1) AT2G21220 49 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT4G34780 49 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT1G75580 48 / 1e-08 SAUR-like auxin-responsive protein family (.1) AT4G34760 47 / 3e-08 SAUR-like auxin-responsive protein family (.1) AT3G60690 48 / 5e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021436 [exp] 67 / 3e-15 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1) Lus10016129 [exp] 66 / 3e-15 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 65 / 1e-14 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1) Lus10016130 [exp] 62 / 1e-13 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1) Lus10004014 [exp] 58 / 6e-12 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10030263 [exp] 56 / 4e-11 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 55 / 5e-11 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10026532 [exp] 52 / 6e-10 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 51 / 1e-09 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G125100 [exp] 68 / 6e-16 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.016G092400 [exp] 65 / 7e-15 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 61 / 4e-13 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 53 / 2e-10 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 53 / 2e-10 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 52 / 3e-10 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 52 / 6e-10 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 52 / 9e-10 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 51 / 9e-10 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.010G253900 [exp] 52 / 2e-09 AT3G20220 93 / 4e-25 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10041336 pacid=23179638 polypeptide=Lus10041336 locus=Lus10041336.g ID=Lus10041336.BGIv1.0 annot-version=v1.0 ATGAAGAAGCTACTACTGACCCGCCGGCAGAGGCGCCCTCGCCGTCGAAGAGGTGTGCCGGAGGACGTTAAGAAAGGACATTTTGCGGCGGTGGTGTGGA ACGGCGCCGACGAAGCCACAAGCAGGAGAGTTGTAGTCCCACTGCGTTGTTTGAGGAATCCTGAGTTTGTGAAGCTGTTGGAGCAAGCCGCCGACGAGTA CGGATTCCGATGTCAAGGTGCCATCACGCTCTGCTGTCGCCGGCTCGCCGACCTCGATGACATTTTGAATCCGTATTGA
AA sequence Show only first row Show all	>Lus10041336 pacid=23179638 polypeptide=Lus10041336 locus=Lus10041336.g ID=Lus10041336.BGIv1.0 annot-version=v1.0 MKKLLLTRRQRRPRRRRGVPEDVKKGHFAAVVWNGADEATSRRVVVPLRCLRNPEFVKLLEQAADEYGFRCQGAITLCCRRLADLDDILNPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28085			SAUR-like auxin-responsive pro...		Lus10041336 [exp]	0	1
AT3G52490			Double Clp-N motif-containing ...		Lus10042638 [exp]	4.5	0.7867
AT1G31450			Eukaryotic aspartyl protease f...		Lus10002630 [exp]	6.3	0.7840
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10021338 [exp]	8.3	0.7573
AT1G32450		NRT1.5	nitrate transporter 1.5 (.1)		Lus10030286 [exp]	9.6	0.7573
					Lus10033096 [exp]	10.7	0.7573
AT1G27220			paired amphipathic helix repea...		Lus10000805 [exp]	11.7	0.7573
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Lus10010229 [exp]	12.7	0.7502
AT3G44150			unknown protein		Lus10021005 [exp]	13.6	0.7412
AT5G63920		TOP3A, AtTOP3al...	topoisomerase 3alpha (.1)		Lus10006779 [exp]	14.4	0.7390
AT4G22410			Ubiquitin C-terminal hydrolase...		Lus10035548 [exp]	15.2	0.7380

Compare expression of checked genes

Lus10041336 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.