Lus10041347 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22880 187 / 4e-62 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT1G07790 187 / 4e-62 HTB1 Histone superfamily protein (.1)
AT3G45980 186 / 2e-61 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 186 / 2e-61 HTB11 Histone superfamily protein (.1)
AT3G53650 183 / 1e-60 Histone superfamily protein (.1)
AT5G59910 182 / 4e-60 HTB4 Histone superfamily protein (.1)
AT2G28720 182 / 7e-60 Histone superfamily protein (.1)
AT2G37470 179 / 6e-59 Histone superfamily protein (.1)
AT5G02570 172 / 2e-56 Histone superfamily protein (.1)
AT3G09480 167 / 1e-54 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037371 192 / 4e-64 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 191 / 1e-63 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10017292 191 / 2e-63 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10005897 189 / 1e-62 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10005893 188 / 1e-62 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10016156 188 / 2e-62 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 187 / 6e-62 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 186 / 1e-61 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10023753 183 / 1e-60 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G029900 189 / 8e-63 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.010G230600 188 / 1e-62 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.010G230801 188 / 1e-62 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.010G231300 187 / 5e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.008G030600 186 / 7e-62 AT5G59910 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091200 186 / 2e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.009G028001 185 / 2e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230701 185 / 3e-61 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.017G123700 184 / 5e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.004G091400 184 / 8e-61 AT2G28720 186 / 1e-61 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10041347 pacid=23180024 polypeptide=Lus10041347 locus=Lus10041347.g ID=Lus10041347.BGIv1.0 annot-version=v1.0
ATGGCGCCCAAGGCAGCGGAGAAGAAGCCGGCAGAGAAGAAGCCAGCCGAGAAGGCACCGGCGGAGAAGAAGCCCAGAGCCGAAAAGAAACTCCCCAAGG
AAGGAGGCGCCGCGGCCGCCGACAAGAAGAAGAAGCGCAACAAGAAGAACGTCGAGACCTACAAGATCTACATCTTCAAGGTCCTGAAGCAAGTCCACCC
TGACATCGGCATCTCCAGCAAAGCCATGGGAATCATGAACAGCTTCATCAACGACATCTTCGAGAAGCTCGCTGCTGAGTCCTCCAGGCTCGCAAGGTAC
AACAAGAAGCCAACCATCACTTCCAGGGAAATCCAGACCGCCGTCCGCCTAGTCCTCCCCGGTGAGCTCGCCAAACACGCCGTCTCTGAAGGAACCAAGG
CCGTCACCAAGTTTACCAGCTCGTGA
AA sequence
>Lus10041347 pacid=23180024 polypeptide=Lus10041347 locus=Lus10041347.g ID=Lus10041347.BGIv1.0 annot-version=v1.0
MAPKAAEKKPAEKKPAEKAPAEKKPRAEKKLPKEGGAAAADKKKKRNKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAAESSRLARY
NKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10041347 0 1
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10017292 1.0 0.9880
AT5G65360 Histone superfamily protein (.... Lus10025439 1.7 0.9838
AT5G59690 Histone superfamily protein (.... Lus10014264 2.4 0.9865
AT1G73620 Pathogenesis-related thaumatin... Lus10009058 2.8 0.9824
AT2G30620 winged-helix DNA-binding trans... Lus10006562 4.5 0.9532
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10021157 4.9 0.9775
AT3G53730 Histone superfamily protein (.... Lus10038481 5.0 0.9808
AT4G38210 ATHEXPALPHA1.23... EXPANSIN 20, expansin A20 (.1) Lus10013849 5.3 0.9488
AT3G63030 MBD4 methyl-CPG-binding domain 4 (.... Lus10027980 5.7 0.9473
AT3G57830 Leucine-rich repeat protein ki... Lus10021022 5.7 0.9458

Lus10041347 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.