Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27970 154 / 2e-50 CKS2 CDK-subunit 2 (.1) AT2G27960 145 / 1e-46 CKS1AT, CKS1 cyclin-dependent kinase-subunit 1 (.1) AT5G22875 68 / 4e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021405 [exp] 149 / 7e-48 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1) Lus10016159 [exp] 149 / 7e-48 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1) Lus10036579 [exp] 102 / 9e-28 AT2G27970 86 / 2e-21 CDK-subunit 2 (.1) Lus10037369 [exp] 87 / 9e-24 AT5G22875 104 / 1e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G004000 [exp] 163 / 9e-54 AT2G27960 166 / 2e-55 cyclin-dependent kinase-subunit 1 (.1) Potri.004G217500 [exp] 154 / 6e-50 AT2G27970 152 / 3e-50 CDK-subunit 2 (.1) Potri.004G217300 [exp] 69 / 2e-16 AT5G22875 88 / 7e-25 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01111 [flax] [poplar] CKS Cyclin-dependent kinase regulatory subunit
Representative CDS sequence Show only first row Show all	>Lus10041349 pacid=23179639 polypeptide=Lus10041349 locus=Lus10041349.g ID=Lus10041349.BGIv1.0 annot-version=v1.0 ATGGGACAAGTCCAGTACTCAGACAAGTATTTTGATGATATCTACGAGTACAGGCACGTCGTCCTTCCTCCAGAAGTGGCCAAACTGCTCCCCAAGAATC GCCTCCTCTCTGAGAACGAATGGCGTGCAATAGGTGTTCAGCAGAGCCGAGGGTGGATCCACTACGCGATCCATCGACCTGAGCCACACATCATGCTTTT CAGGAGGCCTCTCAACTATCAACAGCAGCAAGAGAAAGAGAACCAAGCTCTGGCAGGGAGAAGTAAGCCAGTGATAGACTCATCAAAGGCATTACCGCCG CAAGCCACTTTCCGAGGCCCTTACGTCAACACTGGTTCCCGTGATATCGGTCCTGATTTCCAGTCTTATTCCAAGAAATGA
AA sequence Show only first row Show all	>Lus10041349 pacid=23179639 polypeptide=Lus10041349 locus=Lus10041349.g ID=Lus10041349.BGIv1.0 annot-version=v1.0 MGQVQYSDKYFDDIYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWIHYAIHRPEPHIMLFRRPLNYQQQQEKENQALAGRSKPVIDSSKALPP QATFRGPYVNTGSRDIGPDFQSYSKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27970		CKS2	CDK-subunit 2 (.1)		Lus10041349 [exp]	0	1
AT3G09860			unknown protein		Lus10001400 [exp]	2.8	0.8696
AT2G28230			TATA-binding related factor (T...		Lus10030830 [exp]	3.2	0.8671
AT1G02330			unknown protein		Lus10042403 [exp]	3.9	0.8191
AT5G45600		TAF14b, GAS41	TBP-ASSOCIATED FACTOR 14B, GLI...		Lus10007555 [exp]	5.7	0.8517
AT1G08580			unknown protein		Lus10040441 [exp]	6.0	0.8392
AT1G52500		ATMMH-2, ATMMH-...	FORMAMIDOPYRIMIDINE-DNA GLYCOS...		Lus10035876 [exp]	6.2	0.8232
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10013733 [exp]	6.6	0.8515
AT5G19370			rhodanese-like domain-containi...		Lus10000413 [exp]	8.5	0.8154
AT5G20180			Ribosomal protein L36 (.1.2)		Lus10019412 [exp]	10.0	0.8022
AT5G40530			S-adenosyl-L-methionine-depend...		Lus10022276 [exp]	10.2	0.8390

Compare expression of checked genes

Lus10041349 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.