Lus10041351 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08170 140 / 7e-41 Histone superfamily protein (.1)
AT3G53650 121 / 8e-35 Histone superfamily protein (.1)
AT2G37470 120 / 9e-35 Histone superfamily protein (.1)
AT2G28720 120 / 2e-34 Histone superfamily protein (.1)
AT5G59910 119 / 4e-34 HTB4 Histone superfamily protein (.1)
AT1G07790 119 / 6e-34 HTB1 Histone superfamily protein (.1)
AT3G45980 118 / 1e-33 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1)
AT3G46030 118 / 1e-33 HTB11 Histone superfamily protein (.1)
AT5G22880 118 / 1e-33 HTB2, H2B HISTONE H2B, histone B2 (.1)
AT5G02570 117 / 1e-33 Histone superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036579 184 / 6e-58 AT2G27970 86 / 2e-21 CDK-subunit 2 (.1)
Lus10023753 120 / 2e-34 AT2G37470 203 / 7e-69 Histone superfamily protein (.1)
Lus10005893 118 / 1e-33 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1)
Lus10040855 118 / 1e-33 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1)
Lus10017456 118 / 1e-33 AT2G28720 226 / 1e-77 Histone superfamily protein (.1)
Lus10005897 118 / 1e-33 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1)
Lus10041347 117 / 2e-33 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1)
Lus10037371 117 / 2e-33 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1)
Lus10013544 117 / 3e-33 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G212200 131 / 1e-38 AT1G08170 129 / 1e-37 Histone superfamily protein (.1)
Potri.010G230701 119 / 4e-34 AT5G59910 191 / 3e-63 Histone superfamily protein (.1)
Potri.008G030500 119 / 5e-34 AT5G59910 190 / 4e-63 Histone superfamily protein (.1)
Potri.008G030400 119 / 6e-34 AT5G59910 191 / 2e-63 Histone superfamily protein (.1)
Potri.008G029900 118 / 9e-34 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
Potri.004G091200 118 / 1e-33 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G230600 118 / 1e-33 AT1G07790 205 / 3e-69 Histone superfamily protein (.1)
Potri.010G230801 118 / 1e-33 AT1G07790 205 / 2e-69 Histone superfamily protein (.1)
Potri.017G123700 118 / 1e-33 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
Potri.010G231300 118 / 1e-33 AT1G07790 177 / 3e-58 Histone superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Lus10041351 pacid=23179770 polypeptide=Lus10041351 locus=Lus10041351.g ID=Lus10041351.BGIv1.0 annot-version=v1.0
ATGGCACCGAGGCGGCGGTCGGCGGGGAGAGTGGTCGGAGTGGTTCGATCAACGAGGAAAGTGGTAAAGGAAACTGTTGAAGTCTCCATCCTTGCTGGCG
ACACCCAGGAGACGACTCCGGAAGACAACACCGAAGACATCAACCTTTTGGATACCGAAGAGTTAATTGACGTCGTTACCCCCGAAGCAGGAGTAAAATT
ACAAGAAGACGCAACCACCACCTCCACCGTGAGAACCATCCCCGTGGAGGACGCTGGACCGGAACGGGAGGAGGAACTAGTGATCAGTGAAGATCGTCAA
TTCGAAGACGCAAAACCAAAAAAGGAAGAAAAGAAAGCACCGGAAAAGGAGAAAAAGGTAAATAAGAAGAAGAGAAAGAGCCGATTTGTGGAAGGAGGGG
AAGGGTACAGGAGGTACGTGTACAAGGTGATGAAGCAGGTGCATCCAGATATGAAGATATCCGGGGTTGCTATGAGCATCATCAACAGTTTGATGAAGGA
CATGTTCGAGCGAATTGCTGACGAGGCTGCCACGCTGTCGCGCTACTCCAAGAGGATGACGATCTCGTCTAAGGAGATCCAGGACGCCGTCAAGCTTGTT
CTACCCGGAGAGCTCGGGAAGCACGCTGTCGCCGAGGGATCCAAGGCTGTTGCTAACTACGCCTCTTACTCCCACAACAAGTGA
AA sequence
>Lus10041351 pacid=23179770 polypeptide=Lus10041351 locus=Lus10041351.g ID=Lus10041351.BGIv1.0 annot-version=v1.0
MAPRRRSAGRVVGVVRSTRKVVKETVEVSILAGDTQETTPEDNTEDINLLDTEELIDVVTPEAGVKLQEDATTTSTVRTIPVEDAGPEREEELVISEDRQ
FEDAKPKKEEKKAPEKEKKVNKKKRKSRFVEGGEGYRRYVYKVMKQVHPDMKISGVAMSIINSLMKDMFERIADEAATLSRYSKRMTISSKEIQDAVKLV
LPGELGKHAVAEGSKAVANYASYSHNK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G08170 Histone superfamily protein (.... Lus10041351 0 1
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10019029 1.4 0.9906
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10007640 1.7 0.9767
AT3G52790 peptidoglycan-binding LysM dom... Lus10027407 2.0 0.9891
AT5G24620 Pathogenesis-related thaumatin... Lus10023896 2.0 0.9653
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10024584 3.5 0.9577
AT3G56850 bZIP DPBF3, AREB3 ABA-responsive element binding... Lus10028888 3.9 0.9645
AT4G09570 CPK4, ATCPK4 calcium-dependent protein kina... Lus10009427 4.6 0.9523
AT5G05960 Bifunctional inhibitor/lipid-t... Lus10009872 5.2 0.9474
AT3G53720 ATCHX20 cation/H+ exchanger 20, cation... Lus10025325 7.7 0.9200
AT3G18280 Bifunctional inhibitor/lipid-t... Lus10013030 8.1 0.9363

Lus10041351 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.