Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40390 71 / 1e-14 RS5, SIP1 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) AT3G57520 52 / 3e-08 RS2, ATSIP2 raffinose synthase 2, seed imbibition 2 (.1.2.3) AT5G20250 49 / 3e-07 RS6, DIN10 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4) AT1G55740 48 / 5e-07 RS1, ATSIP1 raffinose synthase 1, seed imbibition 1 (.1) AT4G01970 48 / 8e-07 RS4, ATSTS raffinose synthase 4, stachyose synthase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039945 [exp] 129 / 7e-38 AT5G40390 164 / 8e-58 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Lus10027679 [exp] 127 / 1e-34 AT5G40390 1040 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Lus10022240 [exp] 69 / 4e-14 AT5G40390 744 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Lus10022241 [exp] 65 / 6e-13 AT5G40390 342 / 2e-112 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Lus10017516 [exp] 56 / 2e-09 AT5G20250 1145 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4) Lus10007537 [exp] 54 / 1e-08 AT3G57520 1235 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T124908 [exp] 78 / 3e-17 AT5G40390 1055 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Potri.007G123400 [exp] 74 / 6e-16 AT5G40390 1147 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Potri.004G207900 [exp] 71 / 1e-14 AT5G40390 1145 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Potri.017G036700 [exp] 70 / 1e-14 AT5G40390 1118 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1) Potri.014G118400 [exp] 58 / 2e-10 AT4G01970 1087 / 0.0 raffinose synthase 4, stachyose synthase (.1) Potri.002G193700 [exp] 56 / 2e-09 AT4G01970 1040 / 0.0 raffinose synthase 4, stachyose synthase (.1) Potri.018G126400 [exp] 51 / 7e-08 AT5G20250 1218 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4) Potri.006G065700 [exp] 51 / 9e-08 AT5G20250 1154 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4) Potri.011G166700 [exp] 50 / 1e-07 AT1G55740 1154 / 0.0 raffinose synthase 1, seed imbibition 1 (.1) Potri.015G086400 [exp] 50 / 1e-07 AT3G57520 827 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0058 [flax] [poplar] Glyco_hydro_tim PF05691 [flax] [poplar] Raffinose_syn Raffinose synthase or seed imbibition protein Sip1
Representative CDS sequence Show only first row Show all	>Lus10041370 pacid=23179982 polypeptide=Lus10041370 locus=Lus10041370.g ID=Lus10041370.BGIv1.0 annot-version=v1.0 ATGGCCACCCAATCCTCACCCAAGTCCCCTCCAACATCACCACCTCTTTCATACCTTCCCATCAATCCACTTCCGCCGGTTGCTTCGTCGGGTTCCATAG GGGTGCTGATAGGGATCCGGTTCACGAGCATTTTCCGGTTCAAAGTCTGGTGGACTACCCACTGGGTCGGGAACAGGGGCAGGGAAGTCCAACTCGAGAC CCAAGTGATAATCCTCAACCGAAACGACGACGGATTGACCAGCATGCTCAACTCCGGCGGTGCGATTCAGTTGGTTGAGATGAAGGAAGAGGTCGGACAC TTGATGATGCGCGTTGGAGTGAAGGGATGTGGAGAAATGAAGGCTTCTGCTTCGGAGAAGCCGTCAAGTTGTTGGATGGATGGGAAGGAATTTGAGTTTC AGTATGATGATGATCAGATGGTCACTATTGGAATCCCTTGGCCGGGATCTTGTAGGTTTACTGAAATCGAATACAGATTTTGA
AA sequence Show only first row Show all	>Lus10041370 pacid=23179982 polypeptide=Lus10041370 locus=Lus10041370.g ID=Lus10041370.BGIv1.0 annot-version=v1.0 MATQSSPKSPPTSPPLSYLPINPLPPVASSGSIGVLIGIRFTSIFRFKVWWTTHWVGNRGREVQLETQVIILNRNDDGLTSMLNSGGAIQLVEMKEEVGH LMMRVGVKGCGEMKASASEKPSSCWMDGKEFEFQYDDDQMVTIGIPWPGSCRFTEIEYRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G40390		RS5, SIP1	seed imbibition 1-like, raffin...		Lus10041370 [exp]	0	1
AT5G02190		EMB24, ATASP38,...	PROMOTION OF CELL SURVIVAL 1, ...		Lus10010854 [exp]	3.2	0.8427
AT1G67290		GLOX1	glyoxal oxidase 1, glyoxal oxi...		Lus10012980 [exp]	3.5	0.8637
AT1G67290		GLOX1	glyoxal oxidase 1, glyoxal oxi...		Lus10012981 [exp]	5.1	0.8587
AT4G23490			Protein of unknown function (D...		Lus10028769 [exp]	8.2	0.8434
AT5G42800		M318, TT3, DFR	dihydroflavonol 4-reductase (....		Lus10041031 [exp]	10.2	0.7911
AT1G68560		AXY3, TRG1, XYL...	thermoinhibition resistant ger...		Lus10041457 [exp]	12.2	0.8468
AT1G78570		ATRHM1, RHM1, R...	REPRESSOR OF LRX1 1, ARABIDOPS...		Lus10010942 [exp]	12.7	0.8220
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10017625 [exp]	12.7	0.8113
					Lus10039498 [exp]	16.9	0.8048
AT5G41460			Protein of unknown function (D...		Lus10017514 [exp]	17.3	0.8370

Compare expression of checked genes

Lus10041370 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.