Lus10041371 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036557 120 / 9e-36 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G153500 64 / 7e-13 AT5G19790 79 / 6e-17 related to AP2 11 (.1)
Potri.014G076702 59 / 4e-11 AT5G19790 74 / 5e-15 related to AP2 11 (.1)
PFAM info
Representative CDS sequence
>Lus10041371 pacid=23179608 polypeptide=Lus10041371 locus=Lus10041371.g ID=Lus10041371.BGIv1.0 annot-version=v1.0
ATGAAGAGCATCGAGAAATCTGTGGAACCGAGCATAATCGTGCCGTCTTCAGGGGGGGAGGAGCAGAGCTATTTGGTGGAGCAGGCGGCTGGGAGTTGCT
CGTGGGAGACGTCAAGTGTGTCGGATTGCAGTAATGGGTGGGTTGGGTTCCGGCAGCCGGCGGCGGGTATGGATTTTTCCTCCGACGGGTCGGATTGCAG
CGGCGATCATTACGGGATGTCGGGTCAAATGGTGGAGAATTGGAATTGGATCGATAGTCCTGAGGTTTCGTTCGCGGAGAGTATTATTAGCTCAGAGGAG
GAATCGAGGAGTAAGAGGTTTAAGGTTTCTTCCTCTGTTGCCATCCCTCCGCCATCGTCGTCGTTCTCACCTTGGTCGTATCACAGCGATAGCTGA
AA sequence
>Lus10041371 pacid=23179608 polypeptide=Lus10041371 locus=Lus10041371.g ID=Lus10041371.BGIv1.0 annot-version=v1.0
MKSIEKSVEPSIIVPSSGGEEQSYLVEQAAGSCSWETSSVSDCSNGWVGFRQPAAGMDFSSDGSDCSGDHYGMSGQMVENWNWIDSPEVSFAESIISSEE
ESRSKRFKVSSSVAIPPPSSSFSPWSYHSDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041371 0 1
AT5G19790 AP2_ERF RAP2.11 related to AP2 11 (.1) Lus10041372 1.0 0.9304
AT3G17130 Plant invertase/pectin methyle... Lus10017074 6.5 0.8448
Lus10042011 7.5 0.8988
AT1G61800 ATGPT2, GPT2 ARABIDOPSIS GLUCOSE-6-PHOSPHAT... Lus10007653 10.7 0.8751
AT4G39510 CYP96A12 "cytochrome P450, family 96, s... Lus10018159 11.0 0.8018
AT4G29680 Alkaline-phosphatase-like fami... Lus10032681 11.6 0.8870
AT3G25280 Major facilitator superfamily ... Lus10025881 11.9 0.8138
AT3G21360 2-oxoglutarate (2OG) and Fe(II... Lus10025819 12.3 0.8846
AT1G67330 Protein of unknown function (D... Lus10037026 14.1 0.8709
Lus10036557 14.5 0.8621

Lus10041371 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.