Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10550 39 / 0.0002 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1) AT1G14720 39 / 0.0003 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029165 [exp] 42 / 4e-05 AT1G10550 405 / 5e-143 xyloglucan:xyloglucosyl transferase 33 (.1) Lus10011982 [exp] 41 / 6e-05 AT4G30270 291 / 3e-99 SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) Lus10004580 [exp] 41 / 6e-05 AT4G30270 290 / 9e-99 SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) Lus10013000 [exp] 40 / 0.0002 AT1G10550 397 / 9e-140 xyloglucan:xyloglucosyl transferase 33 (.1) Lus10012834 [exp] 38 / 0.0007 AT5G57550 292 / 5e-99 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) Lus10030484 [exp] 38 / 0.0008 AT4G25810 398 / 9e-141 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G153200 [exp] 150 / 4e-47 AT2G01850 104 / 9e-27 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [flax] [poplar] Concanavalin PF00722 [flax] [poplar] Glyco_hydro_16 Glycosyl hydrolases family 16
Representative CDS sequence Show only first row Show all	>Lus10041373 pacid=23179697 polypeptide=Lus10041373 locus=Lus10041373.g ID=Lus10041373.BGIv1.0 annot-version=v1.0 ATGGCGGATCCGGCCCTCCACCACAAGACCCGACCCATCAAGCAAATTGCCGTGGAGTACACGCCGGAGGCCTGCACACACTGTCCCGACTCCAATTCCA TCACCCTAACCTACGACCACCGCAGCGGAGCTCGGTGGCGGAGCACCAACCGCTTCCTCTACGGCACATTCAGCTCCCGGATCCAGTGTCCGTTAGGAAA CACCAGCGGCTTCAACTTCAACATCTATCTATCTTCTCTGACAACTGGAGGAGGAGATTTTGCACCACATCACCGTCGGAGGAATCGCCTGGAACCATTG CTTGTTGCTCTTATTCCAATCATGAAGTTCCAGTGGTGA
AA sequence Show only first row Show all	>Lus10041373 pacid=23179697 polypeptide=Lus10041373 locus=Lus10041373.g ID=Lus10041373.BGIv1.0 annot-version=v1.0 MADPALHHKTRPIKQIAVEYTPEACTHCPDSNSITLTYDHRSGARWRSTNRFLYGTFSSRIQCPLGNTSGFNFNIYLSSLTTGGGDFAPHHRRRNRLEPL LVALIPIMKFQW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041373 [exp]	0	1
					Lus10022997 [exp]	3.5	0.8477
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10035637 [exp]	3.7	0.8636
AT2G25180	GARP	ARR12	response regulator 12 (.1)		Lus10036303 [exp]	4.2	0.8251
AT5G26650	MADS	AGL36	AGAMOUS-like 36 (.1)		Lus10007592 [exp]	4.6	0.8350
AT4G13230			Late embryogenesis abundant pr...		Lus10011889 [exp]	4.9	0.8646
					Lus10037769 [exp]	6.5	0.7797
AT3G03990			alpha/beta-Hydrolases superfam...		Lus10017296 [exp]	6.5	0.8354
					Lus10020451 [exp]	9.9	0.8529
					Lus10030338 [exp]	11.0	0.6853
AT4G01310			Ribosomal L5P family protein (...		Lus10036391 [exp]	12.8	0.8419

Compare expression of checked genes

Lus10041373 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.