Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61113 154 / 1e-50 Ubiquitin related modifier 1 (.1) AT2G45695 144 / 2e-46 Ubiquitin related modifier 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036551 [exp] 171 / 7e-57 AT3G61113 177 / 1e-59 Ubiquitin related modifier 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G078200 [exp] 144 / 1e-46 AT3G61113 141 / 2e-45 Ubiquitin related modifier 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF09138 [flax] [poplar] Urm1 Urm1 (Ubiquitin related modifier)
Representative CDS sequence Show only first row Show all	>Lus10041378 pacid=23179669 polypeptide=Lus10041378 locus=Lus10041378.g ID=Lus10041378.BGIv1.0 annot-version=v1.0 ATGCAACTCACTCTTGAATTCGGTGGAGGGCTGGAGCTTCTTTGTGATTCAGTAAAGATACATCAAGCCAACGTGGATCTGGAAAATGAGTCATATAAGT TAACGATGAAAGATTTGCTGGCTTGGGTCCGTACCAATTTGATCAAGGAGAGGCCTGAGATGTTCATGAAAGGAGATACCGTGAGGCCTGGTGTTCTAGT TCTGGTGAACGACTGTGATTGGGAGCTGAGTGGGCAGCTTGACACGACTCTGCAAGAGAAAGACGTGGTGGTTTTCATTTCCACCTTGCATGGTGGCTAA
AA sequence Show only first row Show all	>Lus10041378 pacid=23179669 polypeptide=Lus10041378 locus=Lus10041378.g ID=Lus10041378.BGIv1.0 annot-version=v1.0 MQLTLEFGGGLELLCDSVKIHQANVDLENESYKLTMKDLLAWVRTNLIKERPEMFMKGDTVRPGVLVLVNDCDWELSGQLDTTLQEKDVVVFISTLHGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61113			Ubiquitin related modifier 1 (...		Lus10041378 [exp]	0	1
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10019388 [exp]	1.0	0.9347
AT3G58170		ATBET11, ATBS14...	ARABIDOPSIS THALIANA BET1P/SFT...		Lus10033868 [exp]	3.2	0.9313
AT1G29040			unknown protein		Lus10013930 [exp]	3.9	0.9193
AT2G04520			Nucleic acid-binding, OB-fold-...		Lus10000920 [exp]	3.9	0.9120
AT4G19540		INDH, INDL	IND1(iron-sulfur protein requi...		Lus10018779 [exp]	4.0	0.9106
AT4G04470		PMP22	Peroxisomal membrane 22 kDa (M...		Lus10020027 [exp]	4.6	0.9178
AT4G10920		KELP	transcriptional coactivator p1...		Lus10023061 [exp]	5.7	0.9228
AT1G50940		ETFALPHA	electron transfer flavoprotein...		Lus10011156 [exp]	6.0	0.9155
AT4G22310			Uncharacterised protein family...		Lus10011790 [exp]	6.5	0.9180
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10021515 [exp]	8.1	0.9248

Compare expression of checked genes

Lus10041378 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.