Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11480 47 / 2e-07 BSMT1, ATBSMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT5G04370 45 / 7e-07 NAMT1 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) AT1G19640 39 / 0.0001 JMT jasmonic acid carboxyl methyltransferase (.1) AT5G04380 38 / 0.0002 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) AT4G36470 38 / 0.0003 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041380 [exp] 90 / 9e-23 AT4G36470 278 / 4e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036547 [exp] 81 / 1e-19 AT5G66430 243 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10025993 [exp] 81 / 1e-19 AT1G19640 288 / 1e-93 jasmonic acid carboxyl methyltransferase (.1) Lus10036550 [exp] 80 / 4e-19 AT3G11480 249 / 8e-80 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10036548 [exp] 75 / 3e-17 AT5G66430 250 / 1e-77 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10024671 [exp] 69 / 3e-15 AT5G66430 280 / 2e-91 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10041781 [exp] 54 / 2e-10 AT5G66430 54 / 4e-09 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10024271 [exp] 48 / 9e-08 AT1G19640 315 / 2e-105 jasmonic acid carboxyl methyltransferase (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G021300 [exp] 85 / 4e-21 AT3G11480 318 / 1e-106 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022402 [exp] 60 / 3e-12 AT3G11480 261 / 1e-84 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022002 [exp] 59 / 7e-12 AT3G11480 309 / 3e-103 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022400 [exp] 59 / 9e-12 AT3G11480 311 / 4e-104 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022000 [exp] 56 / 1e-10 AT3G11480 300 / 7e-100 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Potri.019G022200 [exp] 55 / 2e-10 AT5G04370 227 / 1e-71 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2) Potri.005G230100 [exp] 49 / 4e-08 AT1G19640 389 / 1e-134 jasmonic acid carboxyl methyltransferase (.1) Potri.014G168232 [exp] 44 / 7e-07 AT1G19640 114 / 1e-30 jasmonic acid carboxyl methyltransferase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF03492 [flax] [poplar] Methyltransf_7 SAM dependent carboxyl methyltransferase
Representative CDS sequence Show only first row Show all	>Lus10041381 pacid=23179756 polypeptide=Lus10041381 locus=Lus10041381.g ID=Lus10041381.BGIv1.0 annot-version=v1.0 ATGAGTTGGGATCCGTACGAAGGGGAAGCGAATGTTGCCGAAGAATCCCATAAGGATGGTGGCTACAATGTGGCCAAGTTGATGAGGGCTGTGGCAGAGC CATTGTTGGTCAGCCATTTCGGTTCCGACGAGCAACTCATCGATGAGGTCTTCCGGAGGTATAGAGTGATTGTATCAGAGTGGATGCGGACTGAGGAGTC TAATTTTGTGAATGTGACTGTCTCACCCACTAAGCAGTACAACTGA
AA sequence Show only first row Show all	>Lus10041381 pacid=23179756 polypeptide=Lus10041381 locus=Lus10041381.g ID=Lus10041381.BGIv1.0 annot-version=v1.0 MSWDPYEGEANVAEESHKDGGYNVAKLMRAVAEPLLVSHFGSDEQLIDEVFRRYRVIVSEWMRTEESNFVNVTVSPTKQYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11480		BSMT1, ATBSMT1	S-adenosyl-L-methionine-depend...		Lus10041381 [exp]	0	1
AT4G28040			nodulin MtN21 /EamA-like trans...		Lus10015498 [exp]	1.4	0.7304
AT5G02280			SNARE-like superfamily protein...		Lus10023793 [exp]	3.0	0.6585
					Lus10017767 [exp]	3.7	0.7776
					Lus10019040 [exp]	15.5	0.5760
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000682 [exp]	19.4	0.6464
AT3G27470			Protein of unknown function (D...		Lus10035228 [exp]	19.4	0.6578
					Lus10003753 [exp]	21.0	0.6464
					Lus10032027 [exp]	21.9	0.5336
AT3G52970		CYP76G1	"cytochrome P450, family 76, s...		Lus10032339 [exp]	22.4	0.6464
AT4G20040			Pectin lyase-like superfamily ...		Lus10008700 [exp]	23.8	0.6464

Compare expression of checked genes

Lus10041381 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.