Lus10041388 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G45640 168 / 4e-54 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036540 221 / 1e-68 AT3G61130 1015 / 0.0 galacturonosyltransferase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G151500 206 / 5e-69 AT2G45640 185 / 3e-61 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Potri.014G074000 185 / 4e-61 AT2G45640 163 / 1e-52 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
Potri.003G119300 181 / 3e-59 AT2G45640 182 / 1e-59 SIN3 ASSOCIATED POLYPEPTIDE 18, SIN3 associated polypeptide P18 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Representative CDS sequence
>Lus10041388 pacid=23179579 polypeptide=Lus10041388 locus=Lus10041388.g ID=Lus10041388.BGIv1.0 annot-version=v1.0
ATGGCGGGAATGGCAGAACCACCGAGGAGACAAGGAGGGAGACCGATGCCGCCTCCTGGTAATAGGGGACCTCCGATTTCCCGAGGCCCGCCTCCTCTTC
CTCCCGTCGATCGCGAGAAGACATGTCCTCTGCTGCTTCGGGTATTCACCAAGATTGGAGGTCATCACGGGAAAGAAGAATTCCAAGTTAGGGGCAAGGA
GCCCAAGGATGAGGTTCAAATCTATACATGGAAGGATGCAACTCTCCGTGAATTGACTGACTTGCTTTCACTTCAATTTGAACATTTGCTCTTAGATTCT
ATCAGGGTCAAAGAAGTGGCTCCAGCAGCAAGGAGAAGAGATGCACTACTGTCATTTGCTTTTGCCTATCCAGATAAGAATGGCCGTTTTGTGGTGCGAG
AGGTTGGGAAGACTTACTCTAACCGGATCGGGAAGTTAGATGATAACAAGGCGTTGGCTGAAATTGGCTTCCAGATTGGAGATTATCTGGATGTGGCAAT
TATGTAA
AA sequence
>Lus10041388 pacid=23179579 polypeptide=Lus10041388 locus=Lus10041388.g ID=Lus10041388.BGIv1.0 annot-version=v1.0
MAGMAEPPRRQGGRPMPPPGNRGPPISRGPPPLPPVDREKTCPLLLRVFTKIGGHHGKEEFQVRGKEPKDEVQIYTWKDATLRELTDLLSLQFEHLLLDS
IRVKEVAPAARRRDALLSFAFAYPDKNGRFVVREVGKTYSNRIGKLDDNKALAEIGFQIGDYLDVAIM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G45640 ATSAP18, HDA19 SIN3 ASSOCIATED POLYPEPTIDE 18... Lus10041388 0 1
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10035128 5.7 0.8430
AT5G47320 RPS19 ribosomal protein S19 (.1) Lus10027711 8.5 0.8528
AT5G09510 Ribosomal protein S19 family p... Lus10041168 9.5 0.8321
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10011773 9.8 0.8565
AT1G63270 ABCI1, ATNAP10 ATP-binding cassette I1, non-i... Lus10022692 13.0 0.8428
AT1G31817 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ri... Lus10007591 13.0 0.8043
AT3G02080 Ribosomal protein S19e family ... Lus10032992 16.3 0.8557
AT1G29990 PFD6, PDF6 prefoldin 6 (.1) Lus10038496 30.8 0.8007
AT5G12110 Glutathione S-transferase, C-t... Lus10026784 33.6 0.8169
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10023730 36.1 0.8357

Lus10041388 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.