Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12550 130 / 5e-38 HPR3 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) AT2G45630 129 / 4e-37 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT1G79870 116 / 7e-33 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) AT5G28310 64 / 2e-13 NAD(P)-binding Rossmann-fold superfamily protein (.1) AT4G34200 59 / 4e-11 EDA9 embryo sac development arrest 9, D-3-phosphoglycerate dehydrogenase (.1) AT1G68010 57 / 2e-10 ATHPR1, HPR hydroxypyruvate reductase (.1.2) AT3G19480 57 / 2e-10 D-3-phosphoglycerate dehydrogenase (.1) AT1G17745 56 / 7e-10 PGDH D-3-phosphoglycerate dehydrogenase (.1.2) AT5G14780 54 / 2e-09 FDH formate dehydrogenase (.1) AT1G01510 50 / 6e-08 AN ANGUSTIFOLIA, NAD(P)-binding Rossmann-fold superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036538 [exp] 207 / 2e-70 AT2G45630 132 / 2e-38 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 160 / 3e-49 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10036537 [exp] 159 / 8e-49 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10011141 [exp] 119 / 6e-36 AT2G45630 139 / 2e-41 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10006708 [exp] 118 / 2e-33 AT1G12550 358 / 4e-124 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Lus10025795 [exp] 118 / 3e-33 AT1G79870 438 / 6e-156 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10025796 [exp] 117 / 4e-33 AT1G79870 466 / 1e-166 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10037552 [exp] 117 / 5e-33 AT1G79870 410 / 6e-145 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10014133 [exp] 117 / 7e-33 AT1G12550 340 / 1e-116 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G073400 [exp] 146 / 9e-44 AT2G45630 405 / 2e-141 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073500 [exp] 144 / 3e-43 AT2G45630 377 / 4e-131 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151100 [exp] 144 / 4e-43 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G113250 [exp] 137 / 2e-40 AT1G12550 340 / 9e-117 hydroxypyruvate reductase 3, D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1) Potri.003G119000 [exp] 135 / 1e-39 AT2G45630 327 / 2e-111 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.002G151200 [exp] 134 / 3e-39 AT2G45630 382 / 3e-133 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.001G183700 [exp] 116 / 2e-32 AT1G79870 404 / 3e-142 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.003G052700 [exp] 115 / 2e-32 AT1G79870 443 / 7e-158 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G073600 [exp] 65 / 8e-15 AT2G45630 73 / 4e-17 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Potri.014G022800 [exp] 61 / 1e-11 AT3G19480 860 / 0.0 D-3-phosphoglycerate dehydrogenase (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [flax] [poplar] NADP_Rossmann PF02826 [flax] [poplar] 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain
Representative CDS sequence Show only first row Show all	>Lus10041391 pacid=23180031 polypeptide=Lus10041391 locus=Lus10041391.g ID=Lus10041391.BGIv1.0 annot-version=v1.0 ATGACGGTTGAATCCGACGTTCTAATCCTCTGGTGTGCATTGACCGACCCAACCAGACATGTGGTCAACGCCCGGGTGATGGAGGTGCTGGGAAAGGAAG GAGTGATCATCAACGTGGCTCGAGGCGCGATGGTTGACAAGGCGGAGCTGGTGAGGCGTTTGGTCCGGGGAGAGATCGCCGGCGCCGGATTGGACGTGTT TGAGAATGAGCCTGATGTTCCTGAGCAGCTGAAGGAGCTGGCGGACAAGGTTGTTCTGAGCCCTCATTGTGGGATTGCCAGGGTGGAGGCAATGGTGGAC TTGAGCCGCCTTGTTGTCGGGATTCTTGAGGCTTTCTTTTCCGGCCGGCCGTTGTTGTCTGAATACTTGGGCGATTGA
AA sequence Show only first row Show all	>Lus10041391 pacid=23180031 polypeptide=Lus10041391 locus=Lus10041391.g ID=Lus10041391.BGIv1.0 annot-version=v1.0 MTVESDVLILWCALTDPTRHVVNARVMEVLGKEGVIINVARGAMVDKAELVRRLVRGEIAGAGLDVFENEPDVPEQLKELADKVVLSPHCGIARVEAMVD LSRLVVGILEAFFSGRPLLSEYLGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G12550		HPR3	hydroxypyruvate reductase 3, D...		Lus10041391 [exp]	0	1
AT2G18260		ATSYP112, SYP11...	syntaxin of plants 112 (.1)		Lus10026005 [exp]	12.7	0.7033
AT1G69630			F-box/RNI-like superfamily pro...		Lus10008245 [exp]	27.0	0.6934
AT1G78840			F-box/RNI-like/FBD-like domain...		Lus10008295 [exp]	40.5	0.6753
					Lus10029097 [exp]	56.6	0.6748
					Lus10009804 [exp]	64.4	0.6382
AT3G50310		MKKK20, MAPKKK2...	MAPKK kinase 20, mitogen-activ...		Lus10011778 [exp]	92.7	0.5981
					Lus10028601 [exp]	134.9	0.6360
AT2G37010		ATNAP12	non-intrinsic ABC protein 12 (...		Lus10023199 [exp]	160.7	0.6127
					Lus10008296 [exp]	198.5	0.6009
					Lus10003766 [exp]	205.3	0.5983

Compare expression of checked genes

Lus10041391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.