Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G45630 45 / 1e-06 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036536 [exp] 97 / 2e-26 AT2G45630 156 / 1e-48 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10036537 [exp] 85 / 1e-20 AT2G45630 384 / 8e-134 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041393 [exp] 85 / 2e-20 AT2G45630 392 / 7e-137 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10041392 [exp] 47 / 3e-07 AT2G45630 150 / 2e-44 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2) Lus10040679 [exp] 42 / 2e-05 AT2G45630 124 / 1e-34 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G151100 [exp] 50 / 5e-08 AT2G45630 400 / 3e-140 D-isomer specific 2-hydroxyacid dehydrogenase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041394 pacid=23179752 polypeptide=Lus10041394 locus=Lus10041394.g ID=Lus10041394.BGIv1.0 annot-version=v1.0 ATGGTCTTTCTAAGTTGGAATCAACAATCAGGGGAGGACCTTGTCGAAGGGGGCACCGTTAGAAAGCCAGTGAAATCACCAAGGCAAGGCAGCATTCCTC CAAGCTCTGACTTACAGGCGGGTCAGCTAGCGGCAACCAGCCTAGAGTGGAGGGAAAAGTGGATAAAAAGAGTGGCTGACCTTGGAACCGAGGGGATAGT CTCCTTTAGAGCCCCAGAGGTGGTTCTTGACGTAGCGATTGCTGGCGGAGATTCTCCTCAAAACGTCGATCAACAACCCGACGGCGCAATCAACGGCGTT GGCCGAATATACATCTCCTGCGTTAGCGATCTTGATCCCTCGGCGACGGCACTCGAGTAA
AA sequence Show only first row Show all	>Lus10041394 pacid=23179752 polypeptide=Lus10041394 locus=Lus10041394.g ID=Lus10041394.BGIv1.0 annot-version=v1.0 MVFLSWNQQSGEDLVEGGTVRKPVKSPRQGSIPPSSDLQAGQLAATSLEWREKWIKRVADLGTEGIVSFRAPEVVLDVAIAGGDSPQNVDQQPDGAINGV GRIYISCVSDLDPSATALE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041394 [exp]	0	1
					Lus10010481 [exp]	3.5	0.9655
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10010482 [exp]	3.7	0.9560
AT1G15260			unknown protein		Lus10037547 [exp]	4.9	0.9540
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Lus10041888 [exp]	5.1	0.9079
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Lus10040975 [exp]	6.2	0.9555
					Lus10014719 [exp]	8.9	0.9500
AT5G50230			Transducin/WD40 repeat-like su...		Lus10015925 [exp]	10.2	0.9449
					Lus10008816 [exp]	11.5	0.9486
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10032210 [exp]	12.7	0.9371
					Lus10002266 [exp]	13.0	0.9345

Compare expression of checked genes

Lus10041394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.