Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G222400 [exp] 51 / 7e-10 AT5G49015 53 / 2e-10 Expressed protein (.1.2) Potri.008G039901 [exp] 46 / 3e-07 AT5G49015 57 / 3e-11 Expressed protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041398 pacid=23179833 polypeptide=Lus10041398 locus=Lus10041398.g ID=Lus10041398.BGIv1.0 annot-version=v1.0 ATGCATCTATGGCCATCGATCAAGCTGAGGGACTCGTTCAGCATCGATTATCTCCGGCGGCTGGAATGGAACCTCCACCGGATGAAAGTCGACAAGAAAA AGAAGCAGCGTCTCCTTCTAGATGACGGCGGTGCTTCTGGAGAGCAAGGTGAAGAGGAAGAAGAAGAAGAAGGAGGAGGGTCCAGTTCAAATAAGGGGTT TATCAACAAGGTTTCTTTCGTATGCAGAGAGATCTTTTTGGTCCTCTCTTGCTGCTATTGCTGTTTCTGCTGTGGAGGTTTGTACTAA
AA sequence Show only first row Show all	>Lus10041398 pacid=23179833 polypeptide=Lus10041398 locus=Lus10041398.g ID=Lus10041398.BGIv1.0 annot-version=v1.0 MHLWPSIKLRDSFSIDYLRRLEWNLHRMKVDKKKKQRLLLDDGGASGEQGEEEEEEEGGGSSSNKGFINKVSFVCREIFLVLSCCYCCFCCGGLY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G49015			Expressed protein (.1.2)		Lus10041398 [exp]	0	1
AT4G09890			Protein of unknown function (D...		Lus10033529 [exp]	81.6	0.7943
AT3G48530		KING1	SNF1-related protein kinase re...		Lus10022458 [exp]	110.6	0.7967
AT5G05700		ATATE1, DLS1, A...	DELAYED LEAF SENESCENCE 1, arg...		Lus10004392 [exp]	145.2	0.7746
AT5G63620			GroES-like zinc-binding alcoho...		Lus10039625 [exp]	159.4	0.7833
AT3G48530		KING1	SNF1-related protein kinase re...		Lus10016763 [exp]	160.9	0.7826
AT3G30340			nodulin MtN21 /EamA-like trans...		Lus10030169 [exp]	173.9	0.7746
AT1G11400		PYM	partner of Y14-MAGO (.1.2.3)		Lus10007180 [exp]	183.5	0.7785

Compare expression of checked genes

Lus10041398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.