Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G51960 145 / 2e-46 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036504 [exp] 148 / 6e-48 AT5G51960 97 / 3e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G044200 [exp] 162 / 4e-53 AT5G51960 144 / 4e-46 unknown protein Potri.010G217300 [exp] 146 / 7e-47 AT5G51960 130 / 7e-41 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [flax] [poplar] LYR-like PF05347 [flax] [poplar] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Lus10041422 pacid=23179882 polypeptide=Lus10041422 locus=Lus10041422.g ID=Lus10041422.BGIv1.0 annot-version=v1.0 ATGAGTTCAGGAAGAACACTAGAAGCTGCAAAGGTGTACAGAAACCTTCTCAAATCTATCAGAAAGCACATTGGGGATGAAGGTTACAAGAGTCACTTTA GAGAATTTGTGACACAGGAGTTCAGGAAGAACTCTAATGTTCTTCCAACAGACAAATCACCATGCATCCAGCAGAAAATCAAGCTTGCCCGGGACTACAC TTACCTGCTCAACAGTGTTCACGATCACAAAGATCTTCTGATTTCTTACAATATAGCAGTGGACAGATCCAATGAAATGAGCAAAGTGCTAGGGAAGTCT GCAGCAAGTGTTGGTCTTCAGCTTCCTGATGTGTATCAGCCTTGA
AA sequence Show only first row Show all	>Lus10041422 pacid=23179882 polypeptide=Lus10041422 locus=Lus10041422.g ID=Lus10041422.BGIv1.0 annot-version=v1.0 MSSGRTLEAAKVYRNLLKSIRKHIGDEGYKSHFREFVTQEFRKNSNVLPTDKSPCIQQKIKLARDYTYLLNSVHDHKDLLISYNIAVDRSNEMSKVLGKS AASVGLQLPDVYQP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G51960			unknown protein		Lus10041422 [exp]	0	1
AT5G47570			unknown protein		Lus10000735 [exp]	2.0	0.9013
AT4G29430		RPS15AE	ribosomal protein S15A E (.1)		Lus10000975 [exp]	3.5	0.9201
AT4G26310			elongation factor P (EF-P) fam...		Lus10030360 [exp]	7.6	0.8433
AT2G44820			unknown protein		Lus10036053 [exp]	12.0	0.8867
AT3G52390			TatD related DNase (.1.2)		Lus10013590 [exp]	12.1	0.8638
AT4G14320			Zinc-binding ribosomal protein...		Lus10000176 [exp]	16.7	0.8907
AT4G26210			Mitochondrial ATP synthase sub...		Lus10001771 [exp]	21.6	0.8824
AT5G11390		WIT1	WPP domain-interacting protein...		Lus10005102 [exp]	23.0	0.8563
AT3G25220		FKBP15-1	FK506-binding protein 15 kD-1 ...		Lus10003170 [exp]	25.5	0.8615
AT3G56210			ARM repeat superfamily protein...		Lus10017416 [exp]	27.7	0.8784

Compare expression of checked genes

Lus10041422 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.