Plant FIBer expression Database

Lus10041434 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024111
[exp]
65 / 3e-13 AT5G56790 317 / 2e-98 Protein kinase superfamily protein (.1)
Lus10041608
[exp]
65 / 3e-13 AT1G55200 318 / 4e-98 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Lus10018897
[exp]
47 / 6e-07 AT5G16860 970 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10028592
[exp]
41 / 8e-05 AT1G43710 789 / 0.0 embryo defective 1075, Pyridoxal phosphate (PLP)-dependent transferases superfamily protein (.1)
Lus10022466
[exp]
0 / 1 AT5G15940 400 / 1e-136 NAD(P)-binding Rossmann-fold superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G189850
[exp]
47 / 6e-07 AT5G56790 319 / 3e-99 Protein kinase superfamily protein (.1)
Potri.001G035900
[exp]
0 / 1 AT5G56790 311 / 1e-96 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10041434 pacid=23146659 polypeptide=Lus10041434 locus=Lus10041434.g ID=Lus10041434.BGIv1.0 annot-version=v1.0
ATGACGCGTTTGATCCGATCAAACGTTCTTCGACCAGAATGGCTTCGGCCAAAAGTAGTTCGTGCTTGGGAGGAATGTGCACACGATGTGCTTGGAGGCC
ACCGATCTGGAAGCAAACGATGCATTCATCATCATCATGTCTGTGGGAGGAAGGCAAAGAGTGGTTATCAGATTGCAGGAACAATCAGATTGATCCTTCA
GCAATTCTCTTTGAAGGTTGCTGACGTCTTGATCCTTTATGGAGCTCTTCACCAAGTTATTAATCCCAGTGGACTCGAGCTCAGTGTTTGGGTTAAACCC
CAAGCTGATTACAGATTAAGTTTCAAGGAAGAAACTTGA
AA sequence
>Lus10041434 pacid=23146659 polypeptide=Lus10041434 locus=Lus10041434.g ID=Lus10041434.BGIv1.0 annot-version=v1.0
MTRLIRSNVLRPEWLRPKVVRAWEECAHDVLGGHRSGSKRCIHHHHVCGRKAKSGYQIAGTIRLILQQFSLKVADVLILYGALHQVINPSGLELSVWVKP
QADYRLSFKEET

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041434
[exp]
0 1
AT3G43660 Vacuolar iron transporter (VIT... Lus10031543
[exp]
1.4 0.8174
AT1G52290 AtPERK15 proline-rich extensin-like rec... Lus10023581
[exp]
9.3 0.8689
Lus10001089
[exp]
18.5 0.7563
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Lus10028457
[exp]
22.2 0.8118
AT4G10950 SGNH hydrolase-type esterase s... Lus10000876
[exp]
27.9 0.8036
AT1G65890 AAE12 acyl activating enzyme 12 (.1) Lus10020787
[exp]
35.0 0.7877
AT2G32590 EMB2795 EMBRYO DEFECTIVE 2795, unknown... Lus10015139
[exp]
40.1 0.8019
AT1G22590 MADS AGL87 AGAMOUS-like 87 (.1.2) Lus10023294
[exp]
45.3 0.8013
AT3G52610 unknown protein Lus10014215
[exp]
51.0 0.7978
AT3G09080 Transducin/WD40 repeat-like su... Lus10021129
[exp]
53.7 0.7763

Lus10041434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.