Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68300 150 / 5e-47 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 116 / 2e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT1G09740 111 / 1e-31 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G58450 107 / 1e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G62550 104 / 7e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT2G47710 101 / 1e-27 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G25930 83 / 1e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G14680 82 / 4e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 82 / 4e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 65 / 1e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034337 [exp] 279 / 7e-98 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 121 / 3e-32 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10029850 [exp] 115 / 3e-32 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10009272 [exp] 105 / 3e-29 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10006701 [exp] 104 / 5e-29 AT2G47710 218 / 1e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007043 [exp] 102 / 4e-28 AT2G47710 214 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 86 / 2e-21 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10014545 [exp] 79 / 9e-19 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10032142 [exp] 78 / 2e-18 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G123200 [exp] 214 / 2e-72 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 205 / 7e-69 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 154 / 3e-48 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121800 [exp] 139 / 2e-42 AT1G68300 146 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G112300 [exp] 125 / 5e-37 AT1G68300 113 / 3e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 124 / 2e-36 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 118 / 5e-34 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123300 [exp] 114 / 8e-33 AT3G25930 104 / 5e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 114 / 8e-33 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G193800 [exp] 112 / 3e-32 AT2G47710 213 / 1e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10041436 pacid=23146986 polypeptide=Lus10041436 locus=Lus10041436.g ID=Lus10041436.BGIv1.0 annot-version=v1.0 ATGGAGAAGGAGAAGAAGAAGGTGATGGTTGCTGTAGACGAGAGCGAGTTCAGCCACTACGCCCTTGAATGGGCTCTTTCCAATTTGGGGGATACCATTT CCAACTCCTCCTCCCCACTCCTCCTCTTCACCGCTCAGCCCCTCTCAGACTTCGCTTATCTCCACGCTTCCACTTTCGGCGCTGCTCCTCCGGAATTGTT GTCGTCCGTACAGGAGAATCAGAACAAGCTTACAACGGCTCTGTTGGAGAAAGCTAAACAGATTTGCACTACCCATGGGGTGGAAGCAGAAACTGAGACT GGAGTTGGGGATCCTAAAGAGGCTATATGTGAGGCGGTAGATAAGCACCGCATCCAGTTGCTTGTGTTGGGAAGTCATAGCCGAGGACCTATTCAGAGGG CTTTCCTGGGAAGTGTTAGCAACTACTGCGTTCACAATGCAAAATGCCCTGTTCTTGTTGTCAAGAAACCAGCTTAA
AA sequence Show only first row Show all	>Lus10041436 pacid=23146986 polypeptide=Lus10041436 locus=Lus10041436.g ID=Lus10041436.BGIv1.0 annot-version=v1.0 MEKEKKKVMVAVDESEFSHYALEWALSNLGDTISNSSSPLLLFTAQPLSDFAYLHASTFGAAPPELLSSVQENQNKLTTALLEKAKQICTTHGVEAETET GVGDPKEAICEAVDKHRIQLLVLGSHSRGPIQRAFLGSVSNYCVHNAKCPVLVVKKPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68300			Adenine nucleotide alpha hydro...		Lus10041436 [exp]	0	1
AT4G17900			PLATZ transcription factor fam...		Lus10030968 [exp]	2.0	0.9563
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10000733 [exp]	2.2	0.9677
AT4G27130			Translation initiation factor ...		Lus10039660 [exp]	4.2	0.9405
AT1G04970			lipid-binding serum glycoprote...		Lus10033808 [exp]	4.9	0.9583
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10022727 [exp]	5.3	0.9622
AT3G15290			3-hydroxyacyl-CoA dehydrogenas...		Lus10012681 [exp]	6.2	0.9395
AT2G32070			Polynucleotidyl transferase, r...		Lus10018330 [exp]	6.6	0.9421
AT2G31090			unknown protein		Lus10017667 [exp]	7.3	0.9437
AT3G61200			Thioesterase superfamily prote...		Lus10018847 [exp]	9.0	0.9204
AT4G24740		AME1, AFC2	FUS3-complementing gene 2 (.1....		Lus10043309 [exp]	10.5	0.9431

Compare expression of checked genes

Lus10041436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.