Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G25420 249 / 4e-82 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) AT1G34220 197 / 6e-59 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT4G35730 188 / 2e-56 Regulator of Vps4 activity in the MVB pathway protein (.1) AT4G29440 146 / 2e-39 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT2G19710 145 / 3e-39 Regulator of Vps4 activity in the MVB pathway protein (.1) AT1G79910 96 / 1e-22 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G13340 95 / 3e-22 Regulator of Vps4 activity in the MVB pathway protein (.1) AT2G14830 86 / 1e-18 Regulator of Vps4 activity in the MVB pathway protein (.1.2) AT1G52315 73 / 1e-14 Regulator of Vps4 activity in the MVB pathway protein (.1) AT4G32350 74 / 2e-14 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034330 [exp] 353 / 1e-122 AT1G25420 218 / 3e-69 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Lus10006061 [exp] 198 / 5e-60 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10028724 [exp] 197 / 9e-60 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Lus10041836 [exp] 177 / 2e-52 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10028383 [exp] 174 / 3e-51 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10000978 [exp] 166 / 2e-46 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10040542 [exp] 165 / 5e-46 AT2G19710 309 / 2e-89 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10041468 [exp] 125 / 6e-33 AT1G13340 239 / 1e-74 Regulator of Vps4 activity in the MVB pathway protein (.1) Lus10034303 [exp] 121 / 2e-31 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G121300 [exp] 270 / 3e-90 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3) Potri.013G117100 [exp] 193 / 1e-57 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.019G087400 [exp] 191 / 1e-56 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.007G059800 [exp] 187 / 4e-56 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.006G149800 [exp] 173 / 7e-49 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.017G113900 [exp] 118 / 2e-31 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.010G127000 [exp] 117 / 5e-30 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.004G100900 [exp] 111 / 1e-27 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1) Potri.013G135700 [exp] 97 / 1e-22 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2) Potri.004G038600 [exp] 93 / 4e-21 AT2G14830 175 / 3e-48 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03398 [flax] [poplar] Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence Show only first row Show all	>Lus10041442 pacid=23146847 polypeptide=Lus10041442 locus=Lus10041442.g ID=Lus10041442.BGIv1.0 annot-version=v1.0 ATGCGTAAGGAGATAGCACAATTCTTGGAAGCTGGCCAAGAAGCTGGCCAAGAAGCAATTGCTCGCATTCGTGTGGAACATGTAATACGGGAACAAAATC TATGGGCTGGTTTTGAGATACTGGAGCTTTTCTGCGAGTTTGTCCTCGCTCGAATTCCAATTCTTGACACTCAGAAAGAATGTCCTGCCGAAGTACGGGA GGCTGTTGCAAGCATAATATTTGCCTCTCCGAGATGTTCAGAAGTTCCAGATCTACTACATATCAAGAACTTATTTACTGCTAAATATGGAAAAGAGTTC GTTATGGCTGCTTCAGAACTTCGTCCCGACTCTGGTGTCAACCGTGCAATAATTGAAAAACTAGCAGTAGATGCTCCTGCACCAGAAGAAAGACTCAAGG TGTTGAAGGAAATTGCCAGAGAGTACAATTTGGAATGGGATTCTTCTGAAACAGAAGCTGAGCTCAATAAAAGACATGAGGATCTTCTGGCTGGATCGAA GAAAGCAGTAGTTGAGGGATCCCCATCTCAAGTCCCCACTATCCAGACTTCTCCCAGTCCCAGCTCTACCTTCAATGGAGCATCATCCGTTGATAGCAGA CGAGAAGAACAAATTGTGCGGGCCCCGGTCAAGACTGACGAAATCGTCCCACCGTCGATCAAAAGTCACTATACGGATCCAGTCAGCCACAGTCGACAGG ATAGGAATCCACAATCGTCTGATGTCCTGGAGGTAGCTCGAGCTGCTATTGCCACAGCAGAGAGAGCTACTGCAGCAGCCCGTGCTGCCGCTGCCCTTGT GAGCGTTAATTTGAGTTCTCAGAAGCTTCAATGA
AA sequence Show only first row Show all	>Lus10041442 pacid=23146847 polypeptide=Lus10041442 locus=Lus10041442.g ID=Lus10041442.BGIv1.0 annot-version=v1.0 MRKEIAQFLEAGQEAGQEAIARIRVEHVIREQNLWAGFEILELFCEFVLARIPILDTQKECPAEVREAVASIIFASPRCSEVPDLLHIKNLFTAKYGKEF VMAASELRPDSGVNRAIIEKLAVDAPAPEERLKVLKEIAREYNLEWDSSETEAELNKRHEDLLAGSKKAVVEGSPSQVPTIQTSPSPSSTFNGASSVDSR REEQIVRAPVKTDEIVPPSIKSHYTDPVSHSRQDRNPQSSDVLEVARAAIATAERATAAARAAAALVSVNLSSQKLQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G25420			Regulator of Vps4 activity in ...		Lus10041442 [exp]	0	1
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036929 [exp]	1.4	0.9385
AT5G47870		RAD52-2B, RAD52...	radiation sensitive 51-2, unkn...		Lus10002565 [exp]	4.7	0.9307
AT3G20920			translocation protein-related ...		Lus10030136 [exp]	4.9	0.9084
AT1G08830		CSD1	copper/zinc superoxide dismuta...		Lus10004139 [exp]	10.4	0.9166
AT2G02960			RING/FYVE/PHD zinc finger supe...		Lus10037172 [exp]	12.3	0.9028
AT1G71840			transducin family protein / WD...		Lus10031629 [exp]	12.4	0.9082
AT3G60800			DHHC-type zinc finger family p...		Lus10024561 [exp]	12.5	0.8878
AT5G11970			Protein of unknown function (D...		Lus10017155 [exp]	12.5	0.9082
AT4G25770			alpha/beta-Hydrolases superfam...		Lus10001320 [exp]	13.5	0.9152
AT2G25280			unknown protein		Lus10001950 [exp]	15.6	0.8991

Compare expression of checked genes

Lus10041442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.