Lus10041454 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G24314 152 / 6e-48 PDE225, PTAC7 PIGMENT DEFECTIVE 225, plastid transcriptionally active7 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G010700 150 / 4e-47 AT5G24314 168 / 5e-54 PIGMENT DEFECTIVE 225, plastid transcriptionally active7 (.1.2)
PFAM info
Representative CDS sequence
>Lus10041454 pacid=23146982 polypeptide=Lus10041454 locus=Lus10041454.g ID=Lus10041454.BGIv1.0 annot-version=v1.0
ATGTCTCTTTCTTCCATGCACTTCGCCTTCTCATCTCTTTCTCCGGTCACCTACCGCAACTCCACCTCCAGGAAACCTCACCCGGTCTTGGCGCAGTCCG
GAAGTGACCGGCGAGTCTGGCGCCGTCGAAAACTGACGAAGGAGGATGACATGAGGAAATACAGAATGGAGAGAGTTCCATTCCTGGAGGAGCAAGTTAG
GACCATGAGAGAAAGTGGGAAGCTGCTCCAGTTCGACATAGAGTGGCTCCAGCGATCTGAAGACAACAAGTATCATTTTGTTAATAAGGTTGCAGCGGAG
GCTACGGAGATGCTAGAGCGCAACCCCGACGAGTACGGTGGGAGCAAGAAACCGATTCTTCATGTCCTTAGCAACATGATGAACGATGCTGGATTTTACA
GGCCTGAGGCTTACGAAGAGACTGACCTCGTAACTTAG
AA sequence
>Lus10041454 pacid=23146982 polypeptide=Lus10041454 locus=Lus10041454.g ID=Lus10041454.BGIv1.0 annot-version=v1.0
MSLSSMHFAFSSLSPVTYRNSTSRKPHPVLAQSGSDRRVWRRRKLTKEDDMRKYRMERVPFLEEQVRTMRESGKLLQFDIEWLQRSEDNKYHFVNKVAAE
ATEMLERNPDEYGGSKKPILHVLSNMMNDAGFYRPEAYEETDLVT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G24314 PDE225, PTAC7 PIGMENT DEFECTIVE 225, plastid... Lus10041454 0 1
AT1G76760 ATY1, TRX-Y1 thioredoxin Y1 (.1) Lus10018875 1.7 0.9048
AT2G41950 unknown protein Lus10029301 2.4 0.9021
AT2G17695 unknown protein Lus10028386 3.0 0.9005
AT3G15690 Single hybrid motif superfamil... Lus10023118 5.5 0.8930
AT4G10000 Thioredoxin family protein (.1... Lus10001283 6.8 0.8581
AT3G09860 unknown protein Lus10023014 7.3 0.8921
AT4G20030 RNA-binding (RRM/RBD/RNP motif... Lus10006936 7.4 0.8763
AT5G66680 DGL1 DEFECTIVE GLYCOSYLATION, dolic... Lus10009792 10.1 0.8085
AT1G27510 Protein of unknown function (D... Lus10027696 12.4 0.8688
AT3G47570 Leucine-rich repeat protein ki... Lus10004827 14.2 0.8494

Lus10041454 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.