Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G68552 36 / 0.0005 CPuORF53 conserved peptide upstream open reading frame 53 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034317 [exp] 120 / 1e-36 AT1G68552 56 / 2e-11 conserved peptide upstream open reading frame 53 (.1) Lus10035017 [exp] 80 / 6e-21 AT1G68552 49 / 7e-09 conserved peptide upstream open reading frame 53 (.1) Lus10021677 [exp] 78 / 3e-20 AT1G68552 50 / 3e-09 conserved peptide upstream open reading frame 53 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G125700 [exp] 40 / 2e-05 AT1G25472 / conserved peptide upstream open reading frame 54 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041455 pacid=23146652 polypeptide=Lus10041455 locus=Lus10041455.g ID=Lus10041455.BGIv1.0 annot-version=v1.0 ATGTCGGCTGAGTTTGATTTGGCTGTTGTGCTTGGGGCTCCTTTGAAGCTCTCTTCCTCTGTTTTGATCTCTTCTCTTTCTGCTGCGCAAACCGCCGCCG TCCTCTGCTCTTTCTTCTGTGCCGTTTCCCGTCTCCGTCGCTTCTTCTGCTGTCCACAGCAGAGATCGTTACTGAGGTCCGCATCTGCTTCGATGCGTTT GAGGCCAAAACGGACTTCTTCTGGCGTGAAGTGCTTTGGGGGTTATCACATAAATCGGTCTTCTCACTTATTCCTGTTCTTGAGAGGGGGTCTCACTTGA
AA sequence Show only first row Show all	>Lus10041455 pacid=23146652 polypeptide=Lus10041455 locus=Lus10041455.g ID=Lus10041455.BGIv1.0 annot-version=v1.0 MSAEFDLAVVLGAPLKLSSSVLISSLSAAQTAAVLCSFFCAVSRLRRFFCCPQQRSLLRSASASMRLRPKRTSSGVKCFGGYHINRSSHLFLFLRGGLT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G68552		CPuORF53	conserved peptide upstream ope...		Lus10041455 [exp]	0	1
AT5G22840			Protein kinase superfamily pro...		Lus10020515 [exp]	1.4	0.8297
AT1G51310			transferases;tRNA (5-methylami...		Lus10039111 [exp]	2.0	0.8060
AT4G19985			Acyl-CoA N-acyltransferases (N...		Lus10003688 [exp]	2.2	0.7739
AT1G68552		CPuORF53	conserved peptide upstream ope...		Lus10034317 [exp]	2.4	0.8446
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10006178 [exp]	4.9	0.7615
					Lus10027352 [exp]	8.4	0.7685
AT3G11710		ATKRS-1	lysyl-tRNA synthetase 1 (.1)		Lus10001625 [exp]	11.0	0.8128
AT4G28010			Tetratricopeptide repeat (TPR)...		Lus10033641 [exp]	15.9	0.7461
AT5G08300			Succinyl-CoA ligase, alpha sub...		Lus10010186 [exp]	18.4	0.7329
AT3G10650		AtNUP1	unknown protein		Lus10028861 [exp]	19.6	0.7706

Compare expression of checked genes

Lus10041455 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.