Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034312 [exp] 140 / 4e-44 AT3G25882 52 / 3e-09 NIM1-interacting 2 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041460 pacid=23147041 polypeptide=Lus10041460 locus=Lus10041460.g ID=Lus10041460.BGIv1.0 annot-version=v1.0 ATGGAAACACCGACGGCCGGAAAGAAGACCAGGAAACGACCACCGGCAGAAGTCAAATCTACAACTCCGGAGAAGGATATCAGATCGCCCAAGGCGGTGC CGGAGGAAGAGGTTGAGGAATTCTTTGCGATATTGAGGAGGATTCACGTTGCCGTTAAGTACTTCAAAAGGAGCGGCGGCGGAGAGAGTAGGAAGAGATG CCGGCCATCGTTTGACAAGGAGGCCGATTTGGTGGAGATCGGCGGCGGCGGGGAAAACGATGTGTATGGGGCGTTAGACGGAGAAGCGGGTAAAGCGGTT GTGGAGGAAGCGGGTTTGGATCTGAATTTGGATCCCCCTCCGGATCTAACTTCCGATGATAATTAG
AA sequence Show only first row Show all	>Lus10041460 pacid=23147041 polypeptide=Lus10041460 locus=Lus10041460.g ID=Lus10041460.BGIv1.0 annot-version=v1.0 METPTAGKKTRKRPPAEVKSTTPEKDIRSPKAVPEEEVEEFFAILRRIHVAVKYFKRSGGGESRKRCRPSFDKEADLVEIGGGGENDVYGALDGEAGKAV VEEAGLDLNLDPPPDLTSDDN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25882		NIMIN-2	NIM1-interacting 2 (.1)		Lus10041460 [exp]	0	1
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10000453 [exp]	3.6	0.8485
AT2G31880		SOBIR1, EVR	SUPPRESSOR OF BIR1 1, EVERSHED...		Lus10013675 [exp]	4.6	0.8038
AT2G43590			Chitinase family protein (.1)		Lus10035620 [exp]	6.6	0.8007
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10024087 [exp]	7.3	0.8146
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10016464 [exp]	7.5	0.7928
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10002208 [exp]	7.6	0.7618
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10026262 [exp]	11.0	0.7951
AT4G24040		TREHALASE1, ATT...	trehalase 1 (.1)		Lus10023034 [exp]	12.2	0.7801
AT5G41610		ATCHX18	cation/H+ exchanger 18, ARABID...		Lus10017540 [exp]	15.9	0.7807
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10016323 [exp]	17.3	0.7818

Compare expression of checked genes

Lus10041460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.