Lus10041462 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G30790 50 / 3e-07 F-box and associated interaction domains-containing protein (.1)
AT2G41473 45 / 1e-06 F-box family protein (.1)
AT5G44220 45 / 7e-06 F-box family protein (.1)
AT1G31080 45 / 8e-06 F-box family protein (.1)
AT1G50870 45 / 1e-05 F-box and associated interaction domains-containing protein (.1)
AT1G53790 45 / 2e-05 F-box and associated interaction domains-containing protein (.1.2)
AT1G47790 44 / 2e-05 F-box and associated interaction domains-containing protein (.1)
AT4G38870 44 / 2e-05 F-box and associated interaction domains-containing protein (.1)
AT1G31090 44 / 3e-05 F-box family protein (.1)
AT1G30920 43 / 5e-05 F-box family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034309 144 / 2e-41 AT4G38870 84 / 4e-18 F-box and associated interaction domains-containing protein (.1)
Lus10013934 86 / 1e-19 AT1G11270 72 / 7e-14 F-box and associated interaction domains-containing protein (.1.2.3)
Lus10014979 85 / 1e-19 AT1G33530 57 / 6e-09 F-box family protein (.1)
Lus10003705 85 / 2e-19 AT4G38870 72 / 1e-13 F-box and associated interaction domains-containing protein (.1)
Lus10011190 81 / 9e-18 AT1G32420 78 / 1e-15 F-box and associated interaction domains-containing protein (.1)
Lus10016866 80 / 1e-17 AT1G32420 84 / 2e-17 F-box and associated interaction domains-containing protein (.1)
Lus10011200 78 / 2e-17 AT1G47790 84 / 2e-18 F-box and associated interaction domains-containing protein (.1)
Lus10011197 78 / 8e-17 AT1G47790 86 / 6e-18 F-box and associated interaction domains-containing protein (.1)
Lus10011210 69 / 5e-14 AT1G32420 87 / 7e-19 F-box and associated interaction domains-containing protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G458400 53 / 2e-08 AT2G31470 113 / 8e-28 DROUGHT TOLERANCE REPRESSOR, F-box and associated interaction domains-containing protein (.1)
Potri.010G154500 51 / 1e-07 AT4G12560 139 / 7e-37 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.016G012700 50 / 2e-07 AT4G12560 143 / 3e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.008G199601 45 / 1e-06 AT3G06240 61 / 2e-12 F-box family protein (.1)
Potri.019G062900 47 / 2e-06 AT1G50870 69 / 1e-12 F-box and associated interaction domains-containing protein (.1)
Potri.012G099733 46 / 6e-06 AT3G16210 92 / 2e-20 F-box family protein (.1)
Potri.013G093100 45 / 8e-06 AT1G50870 80 / 2e-16 F-box and associated interaction domains-containing protein (.1)
Potri.017G058900 44 / 3e-05 AT3G06240 132 / 2e-34 F-box family protein (.1)
Potri.006G012900 43 / 5e-05 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
Potri.014G162600 43 / 6e-05 AT3G07870 467 / 9e-164 F-box and associated interaction domains-containing protein (.1)
PFAM info
Representative CDS sequence
>Lus10041462 pacid=23146806 polypeptide=Lus10041462 locus=Lus10041462.g ID=Lus10041462.BGIv1.0 annot-version=v1.0
ATGCCGGTTCTTCGCCTGAAACCTAGGAAACTTGCATCTAAAGTAACCAAAGGGTGCAATGAACACAACAAGAACAAGAAGACGAAGCAGAAGAAGAGAT
TTACATGTGGTGATTATGACAAGGCTACTCAAGCTGCCAGTTGTTTAATTGCCAATGATAATCAGGTGGTTTCTCAGATATTCAGCAGGCTACCAGTGAA
GTCCTTTATGCTGTTCAAGTGCGTTTCTAAAGCTTGGAAGTCGATTATCGAACAAGATTCGCACTTTATCAATTTACACTACAACCATTCAGTAGGACGC
CCAGGGTTGTTAATTTTCACCACCGGTAGTAGTACAAAGTATCCCAAAAGTTGTTGTCATCAGTTGTCTTTGCTGTCAGTTGATTTGCACTCTGATGATG
ACATTATCCGCGGAGCCAACGTTCGCAGCGTAAAGACGATACAGTCGTCAATCCCTAAAGATGTCAAGTTTCTAGACCCCGTTGCAGGATTGCTCTGTTT
GGTTGTCCACTTTGCTTTACAGTACAGATATGCAATGTCATCACTGGAGTAA
AA sequence
>Lus10041462 pacid=23146806 polypeptide=Lus10041462 locus=Lus10041462.g ID=Lus10041462.BGIv1.0 annot-version=v1.0
MPVLRLKPRKLASKVTKGCNEHNKNKKTKQKKRFTCGDYDKATQAASCLIANDNQVVSQIFSRLPVKSFMLFKCVSKAWKSIIEQDSHFINLHYNHSVGR
PGLLIFTTGSSTKYPKSCCHQLSLLSVDLHSDDDIIRGANVRSVKTIQSSIPKDVKFLDPVAGLLCLVVHFALQYRYAMSSLE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G30790 F-box and associated interacti... Lus10041462 0 1
AT5G66730 C2H2ZnF IDD1, ENY INDETERMINATE DOMAIN 1, ENHYDR... Lus10007168 23.5 0.6403
AT3G15630 unknown protein Lus10017768 31.1 0.6259

Lus10041462 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.