Lus10041463 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G34890 122 / 5e-33 ATXDH1 xanthine dehydrogenase 1 (.1)
AT4G34900 121 / 7e-33 ATXDH2 A. THALIANA XANTHINE DEHYDROGENASE 2, xanthine dehydrogenase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034306 164 / 1e-47 AT4G34890 2127 / 0.0 xanthine dehydrogenase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G054600 138 / 9e-39 AT4G34890 2077 / 0.0 xanthine dehydrogenase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0077 FAD_PCMH PF00941 FAD_binding_5 FAD binding domain in molybdopterin dehydrogenase
Representative CDS sequence
>Lus10041463 pacid=23146880 polypeptide=Lus10041463 locus=Lus10041463.g ID=Lus10041463.BGIv1.0 annot-version=v1.0
ATGGGCGACATTCAACACAATGAGCACAATAACCAGGAAGTCGTCCACGTGCATTCAGCTATACTACGACAAAAGAGACTCCAGTATCAGACTTTGATCC
ATGTGGCTCATGTACCTGACTTGAACGTTAAGGACATGCAACTTCTTAGAAAGGTAGCAAGTGAGCATGCTGGTCTCACGAAACATCATCTTTTGAAGTG
GTTTGCAGGAACTCGAATAAAGAATGTTGCATCTGGTGGAGGCAATATTTGCACAGCCAGTCCGATATCTGATTTAAACCCACTCTGGATGGCTGCAAGA
ACAAAGTTTCGAATTATTGACTCAAAGGGAAACATTAGAACTACACAGGCAGATAAGTTCTTCCTGGGTTACAAGAAAGGTGGATCGTCAGAGTGGTGA
AA sequence
>Lus10041463 pacid=23146880 polypeptide=Lus10041463 locus=Lus10041463.g ID=Lus10041463.BGIv1.0 annot-version=v1.0
MGDIQHNEHNNQEVVHVHSAILRQKRLQYQTLIHVAHVPDLNVKDMQLLRKVASEHAGLTKHHLLKWFAGTRIKNVASGGGNICTASPISDLNPLWMAAR
TKFRIIDSKGNIRTTQADKFFLGYKKGGSSEW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34890 ATXDH1 xanthine dehydrogenase 1 (.1) Lus10041463 0 1
AT2G24520 AHA5 H\(+\)-ATPase 5, H\(+\)-ATPase... Lus10020148 26.4 0.6046
AT3G03380 DEG7, DEGP7 degradation of periplasmic pro... Lus10017636 42.4 0.5832
AT2G40410 Staphylococcal nuclease homolo... Lus10041146 68.8 0.5683
AT4G17905 ATL4H RING/U-box superfamily protein... Lus10024405 88.7 0.5387
AT1G69630 F-box/RNI-like superfamily pro... Lus10031499 89.7 0.5339
Lus10039973 92.5 0.5294
AT4G14103 F-box/RNI-like superfamily pro... Lus10020634 99.7 0.5486
Lus10039431 102.3 0.5278
Lus10024734 130.5 0.5119
AT1G63320 Pentatricopeptide repeat (PPR)... Lus10009331 145.4 0.5288

Lus10041463 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.