Lus10041468 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G13340 226 / 1e-69 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G35730 159 / 1e-43 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G34220 161 / 2e-43 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G19710 155 / 1e-40 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT1G25420 146 / 4e-40 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
AT4G29440 146 / 1e-37 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT2G14830 117 / 1e-28 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G79910 100 / 5e-23 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
AT1G52315 96 / 2e-21 Regulator of Vps4 activity in the MVB pathway protein (.1)
AT4G32350 90 / 4e-19 Regulator of Vps4 activity in the MVB pathway protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034303 449 / 4e-156 AT1G13340 243 / 5e-76 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10033552 239 / 3e-75 AT1G13340 208 / 6e-64 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10017592 210 / 5e-64 AT1G13340 178 / 3e-52 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10017591 189 / 2e-57 AT1G13340 158 / 3e-46 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10041836 167 / 1e-46 AT4G35730 423 / 2e-145 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10006061 166 / 6e-46 AT1G34220 417 / 2e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10028383 164 / 9e-46 AT4G35730 415 / 2e-142 Regulator of Vps4 activity in the MVB pathway protein (.1)
Lus10028724 165 / 1e-45 AT1G34220 417 / 1e-140 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Lus10000978 161 / 1e-42 AT2G19710 308 / 6e-89 Regulator of Vps4 activity in the MVB pathway protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G127000 296 / 3e-96 AT1G13340 268 / 1e-85 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.017G113900 242 / 3e-77 AT1G13340 211 / 9e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.004G100900 251 / 8e-77 AT1G13340 223 / 1e-66 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.019G087400 165 / 3e-45 AT1G34220 357 / 5e-116 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.007G059800 161 / 3e-44 AT4G35730 385 / 7e-130 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.006G149800 165 / 5e-44 AT2G19710 300 / 3e-86 Regulator of Vps4 activity in the MVB pathway protein (.1)
Potri.008G121300 153 / 6e-43 AT1G25420 361 / 3e-125 Regulator of Vps4 activity in the MVB pathway protein (.1.2.3)
Potri.013G117100 159 / 7e-43 AT1G34220 357 / 2e-115 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.013G135700 105 / 3e-24 AT2G14830 228 / 2e-67 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
Potri.003G054500 102 / 2e-23 AT1G79910 216 / 4e-65 Regulator of Vps4 activity in the MVB pathway protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03398 Ist1 Regulator of Vps4 activity in the MVB pathway
Representative CDS sequence
>Lus10041468 pacid=23147009 polypeptide=Lus10041468 locus=Lus10041468.g ID=Lus10041468.BGIv1.0 annot-version=v1.0
ATGGGGAAGAAGCTGGACGCAATTCTAGGAAGGAACAACTTCAAAACATACAAGTTCAAGGCACTCTCCAACCTCGCCGTTTCTCGCCTTGCCATCTTCA
AGAACCAGCGTCAAGCTAAGCTAAACCAAGCTCGCTCCGACGTCCTCGATCTCCTCCGCCTCGGCCACCGTGACCGTGCCCTCCTACGGGCGGAGCATGT
GATCAAGGAGCAGAACATGTTGGAAGCGTATGGCATGATGGAGGATTACTGCAACCTTCTTGTGGAGAGGGTTCATCTCCTCGAACAAGAAAGGGTATGC
CCTGATGAACTGAAGGAGGCGATTTCGAGTTTGCTCTTTGCATCGTCCAGGTGCGGTGAATTTCCCGAGCTTCACGAGATGCGTCTGGTGTTCACTTCGC
GGTATGGTAAGGAGTTTGCTGCTAGCGCTGTTGAGTTGCGCAACAATTGTGGAGTCAATCGTAGGATGATGCAGAAGATGTCTACTAGGCAGCCTGACCT
GGAGACCAAAACCAAACTGTTGCGAGAGATTGCATCTGAGAACAATATTGCCTTTGAACTAGATGATGAAACTTCTCCTCCTTCTTTGACAACAGCAACC
TACAAGGAAAAGTTCAAAGCTGGCAGAAAGGAAGAAGAGGGTGAGTCATCGGTTGCAGCTGAAGAAATTGGGAGAAATGATGATCTCACCGATTCGGTGA
GAGCGAGGAGGAAGTATAAGGATGTAGCTGAAGCAGCTCAGGCAGCATTCAAATCGGCTGCCTATGCAGCAGAAGCAGCGAGAGCTGCCGTTGAACTCTC
TCGATCCGATCCTCGTCATCCTGGCAGCAGCAGCAGCAGCAGCCACCACAGTTCTGAAGATGATGATGGCAATGTTGTTAATGATTCTGATGATGGTAAG
AGGCAGCTACTTAGCCAATATGAAGATGGCATAGATTCTGAATCTGGGGATGAGGAACAGGATGTTGAGATCAAAGCTGGTTTGGAAGTCAAGTCATCTT
CTTCGAGCCTTCATCCTGAGAATCTGGCCAGAAAACTGGACAGAGATATCGAAATCAATTATAGTGATATTGAAGAGGATGACGATCATCAGAACACAAA
TGTAGCGAAATCTGATATGCTTGGAAGCGATGAGGGAGCAGCAGCAAATGCCGATACCAGTGAGCAAATCCCCACGGTTATACAAACAGGGGTGAAGGTG
GAATCAGTAGATGTTATATACCCGAATCCACAAGGCTCTAGAGAATCAAGAACTACACGCACCTTGAACATACTCAAGGCACCATTCTCTGTCAGGACCA
CCAGACACGTCCGTGGATACTGA
AA sequence
>Lus10041468 pacid=23147009 polypeptide=Lus10041468 locus=Lus10041468.g ID=Lus10041468.BGIv1.0 annot-version=v1.0
MGKKLDAILGRNNFKTYKFKALSNLAVSRLAIFKNQRQAKLNQARSDVLDLLRLGHRDRALLRAEHVIKEQNMLEAYGMMEDYCNLLVERVHLLEQERVC
PDELKEAISSLLFASSRCGEFPELHEMRLVFTSRYGKEFAASAVELRNNCGVNRRMMQKMSTRQPDLETKTKLLREIASENNIAFELDDETSPPSLTTAT
YKEKFKAGRKEEEGESSVAAEEIGRNDDLTDSVRARRKYKDVAEAAQAAFKSAAYAAEAARAAVELSRSDPRHPGSSSSSSHHSSEDDDGNVVNDSDDGK
RQLLSQYEDGIDSESGDEEQDVEIKAGLEVKSSSSSLHPENLARKLDRDIEINYSDIEEDDDHQNTNVAKSDMLGSDEGAAANADTSEQIPTVIQTGVKV
ESVDVIYPNPQGSRESRTTRTLNILKAPFSVRTTRHVRGY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G13340 Regulator of Vps4 activity in ... Lus10041468 0 1
AT1G13340 Regulator of Vps4 activity in ... Lus10034303 1.0 0.8486
AT1G18760 Zinc finger, C3HC4 type (RING ... Lus10006279 3.0 0.7585
AT4G10270 Wound-responsive family protei... Lus10033729 3.0 0.7932
AT1G52343 unknown protein Lus10035888 4.5 0.7585
AT4G34970 ADF9 actin depolymerizing factor 9 ... Lus10034494 5.3 0.7641
AT4G33920 Protein phosphatase 2C family ... Lus10011521 7.1 0.8039
AT5G24320 Transducin/WD40 repeat-like su... Lus10022377 7.4 0.7537
AT5G45100 BRG1 BOI-related gene 1, SBP (S-rib... Lus10040613 8.8 0.7229
AT5G18260 RING/U-box superfamily protein... Lus10035820 10.8 0.6863
AT3G29090 PME31, ATPME31 A. THALIANA PECTIN METHYLESTER... Lus10014338 11.4 0.7826

Lus10041468 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.