Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034301 [exp] 146 / 8e-43 AT3G18440 555 / 0.0 aluminum-activated malate transporter 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G127400 [exp] 53 / 3e-09 AT3G18440 588 / 0.0 aluminum-activated malate transporter 9 (.1) Potri.015G053400 [exp] 44 / 3e-06 AT3G18440 681 / 0.0 aluminum-activated malate transporter 9 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10041470 pacid=23146953 polypeptide=Lus10041470 locus=Lus10041470.g ID=Lus10041470.BGIv1.0 annot-version=v1.0 ATGGAGAAGCTAGGAGGAGGAGGAGGAGGAGGAGCAACAGTACTAGACGACAGTAACATCCGAAACGACATCCACGAAGCTGTAGACCTCCTACAGAACA AGATCGACTGTAAATCCCACCTCCTCCTCAACCCTACAGATCAGACCAGCTTCCCAGCAATTTCCAGACAAGACTCCGTAAATGTCCAAACCGATTTGAG CGAAAACCCGGATCTGCATCTGGGAATCAAGTCGTTGAGTGAAGCAGTGCTGGACTTGAGGGCAATCCAGTTGGTTAAATGGCCTTCTTGA
AA sequence Show only first row Show all	>Lus10041470 pacid=23146953 polypeptide=Lus10041470 locus=Lus10041470.g ID=Lus10041470.BGIv1.0 annot-version=v1.0 MEKLGGGGGGGATVLDDSNIRNDIHEAVDLLQNKIDCKSHLLLNPTDQTSFPAISRQDSVNVQTDLSENPDLHLGIKSLSEAVLDLRAIQLVKWPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10041470 [exp]	0	1
AT3G09550			Ankyrin repeat family protein ...		Lus10003986 [exp]	1.0	0.7747
AT3G09660		MCM8	minichromosome maintenance 8 (...		Lus10015060 [exp]	8.7	0.7468
AT5G14070		ROXY2	Thioredoxin superfamily protei...		Lus10038514 [exp]	12.1	0.7412
AT5G10770			Eukaryotic aspartyl protease f...		Lus10026243 [exp]	20.7	0.7283
AT2G38360		PRA1.B4	prenylated RAB acceptor 1.B4 (...		Lus10042099 [exp]	28.3	0.6034
AT1G79800		AtENODL7	early nodulin-like protein 7 (...		Lus10018758 [exp]	30.8	0.7052
AT4G30610		SCPL24, BRS1	SERINE CARBOXYPEPTIDASE 24 PRE...		Lus10015489 [exp]	34.3	0.7139
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Lus10026876 [exp]	35.2	0.6762
					Lus10034724 [exp]	37.1	0.6800
AT1G16510			SAUR-like auxin-responsive pro...		Lus10040643 [exp]	37.2	0.6625

Compare expression of checked genes

Lus10041470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.