Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18440 80 / 6e-19 ATALMT9 aluminum-activated malate transporter 9 (.1) AT1G68600 64 / 2e-13 Aluminium activated malate transporter family protein (.1) AT1G25480 64 / 2e-13 Aluminium activated malate transporter family protein (.1) AT2G17470 62 / 9e-13 AtALMT6, ALMT6 ALuminium activated Malate Transporter 6, Aluminium activated malate transporter family protein (.1) AT1G18420 60 / 8e-12 Aluminium activated malate transporter family protein (.1) AT4G17970 39 / 0.0002 ATALMT12, ALMT12 "aluminum-activated, malate transporter 12", aluminum-activated, malate transporter 12 (.1) AT5G46600 39 / 0.0002 Aluminium activated malate transporter family protein (.1) AT5G46610 37 / 0.0005 Aluminium activated malate transporter family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034301 [exp] 149 / 5e-44 AT3G18440 555 / 0.0 aluminum-activated malate transporter 9 (.1) Lus10039925 [exp] 70 / 2e-15 AT3G18440 290 / 5e-94 aluminum-activated malate transporter 9 (.1) Lus10027657 [exp] 69 / 3e-15 AT3G18440 711 / 0.0 aluminum-activated malate transporter 9 (.1) Lus10035037 [exp] 65 / 1e-13 AT1G25480 295 / 3e-94 Aluminium activated malate transporter family protein (.1) Lus10024711 [exp] 50 / 2e-08 AT3G18440 76 / 9e-16 aluminum-activated malate transporter 9 (.1) Lus10017222 [exp] 46 / 4e-07 AT3G18440 80 / 5e-17 aluminum-activated malate transporter 9 (.1) Lus10032328 [exp] 45 / 1e-06 AT3G18440 102 / 1e-24 aluminum-activated malate transporter 9 (.1) Lus10000898 [exp] 37 / 0.0008 AT4G17970 666 / 0.0 "aluminum-activated, malate transporter 12", aluminum-activated, malate transporter 12 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G127400 [exp] 73 / 1e-16 AT3G18440 588 / 0.0 aluminum-activated malate transporter 9 (.1) Potri.008G118600 [exp] 72 / 3e-16 AT1G25480 646 / 0.0 Aluminium activated malate transporter family protein (.1) Potri.015G053400 [exp] 71 / 7e-16 AT3G18440 681 / 0.0 aluminum-activated malate transporter 9 (.1) Potri.003G134100 [exp] 46 / 5e-07 AT3G18440 306 / 2e-97 aluminum-activated malate transporter 9 (.1) Potri.001G097300 [exp] 43 / 7e-06 AT3G18440 307 / 2e-97 aluminum-activated malate transporter 9 (.1) Potri.001G144300 [exp] 39 / 0.0002 AT4G17970 634 / 0.0 "aluminum-activated, malate transporter 12", aluminum-activated, malate transporter 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0307 [flax] [poplar] FUSC PF11744 [flax] [poplar] ALMT Aluminium activated malate transporter
Representative CDS sequence Show only first row Show all	>Lus10041471 pacid=23146784 polypeptide=Lus10041471 locus=Lus10041471.g ID=Lus10041471.BGIv1.0 annot-version=v1.0 ATGGAATCAGCAGCAGCAAGAGGAGGAGATCATGGGAGCGTAAGGACTTATGAGAGTGCGAGTGCTTTGTCGTTGGTTAAGTTTGCTTCCTTGTTGATTG AGTTTGTTGCCAGGTTGCAGAATGTGGTTGATTCGTACCAGGAATTGAGTGAGAAAGCTGGGTTTCTGGAGCCTAAAAAGCTTGAATCTTCTTATCCTGT TCTTGAGCGGAGGCGAGTTGGAGTTTGTAGTTGGGTGTTTAGTTGCTTTGGGTTGTTGAAAAGGAGCTATTTGGTGGTTTAG
AA sequence Show only first row Show all	>Lus10041471 pacid=23146784 polypeptide=Lus10041471 locus=Lus10041471.g ID=Lus10041471.BGIv1.0 annot-version=v1.0 MESAAARGGDHGSVRTYESASALSLVKFASLLIEFVARLQNVVDSYQELSEKAGFLEPKKLESSYPVLERRRVGVCSWVFSCFGLLKRSYLVV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18440		ATALMT9	aluminum-activated malate tran...		Lus10041471 [exp]	0	1
AT3G48200			unknown protein		Lus10008827 [exp]	6.2	0.8184
AT5G41850			alpha/beta-Hydrolases superfam...		Lus10021037 [exp]	7.2	0.8160
AT1G13570			F-box/RNI-like superfamily pro...		Lus10004851 [exp]	7.4	0.7714
AT1G26930			Galactose oxidase/kelch repeat...		Lus10024239 [exp]	15.1	0.7750
					Lus10030126 [exp]	16.6	0.7376
AT1G30520		AAE14	acyl-activating enzyme 14 (.1)		Lus10009704 [exp]	19.1	0.7510
AT5G51010			Rubredoxin-like superfamily pr...		Lus10027889 [exp]	19.7	0.7529
					Lus10027391 [exp]	20.4	0.7554
AT1G54680			unknown protein		Lus10033821 [exp]	28.6	0.7730
					Lus10022623 [exp]	31.7	0.7197

Compare expression of checked genes

Lus10041471 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.