Lus10041479 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G68660 235 / 1e-80 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034292 326 / 2e-116 AT1G68660 234 / 3e-80 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Lus10035041 240 / 2e-82 AT1G68660 247 / 2e-85 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G117800 243 / 9e-84 AT1G68660 271 / 1e-94 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.010G128500 226 / 5e-77 AT1G68660 256 / 1e-88 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.010G096600 55 / 9e-10 AT1G68660 60 / 1e-11 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
Potri.008G145500 54 / 1e-09 AT1G68660 62 / 8e-13 Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein ClpS family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02617 ClpS ATP-dependent Clp protease adaptor protein ClpS
Representative CDS sequence
>Lus10041479 pacid=23147033 polypeptide=Lus10041479 locus=Lus10041479.g ID=Lus10041479.BGIv1.0 annot-version=v1.0
ATGGTGAGTGCGTTGTGCGGGAGAATCAGCCTCTCCCCTCATCCCTTATTCAATCCCAACCCTCCAGGTGAGAGGAACTCTCTACGCAGAGGACGATGTA
ATAACCATCGGGTTCTCATGGCAGCATCAGCTCCAGCATTGAGTAAAGGTGGAGGAGTACTGGATAGACCAGTCAAAGAGAAAACCAAGCCCGGGCGTGA
TTCTGAGTTTGACTTGAGGAAATCTAAGAAAATGTCTCCCCCGTATCAAGTGATGCTGCACAACGACAACTTCAACAGACGGGAATACGTGGTCCAAGTA
CTGATGAAGGTCATCCCAGGGATGACAGTGGACAATGCAGTAAATATAATGCAAGAGGCACACATCAACGGCTTGGCGGTGGTGATTATATGCGCCCAGG
GCGATGCGGAAGACCATTGCACGCAGCTGAGAGGGAACGGGCTTATGAGTTCAATTGAACCTGCAAGCGGTGGCGGATGTTAG
AA sequence
>Lus10041479 pacid=23147033 polypeptide=Lus10041479 locus=Lus10041479.g ID=Lus10041479.BGIv1.0 annot-version=v1.0
MVSALCGRISLSPHPLFNPNPPGERNSLRRGRCNNHRVLMAASAPALSKGGGVLDRPVKEKTKPGRDSEFDLRKSKKMSPPYQVMLHNDNFNRREYVVQV
LMKVIPGMTVDNAVNIMQEAHINGLAVVIICAQGDAEDHCTQLRGNGLMSSIEPASGGGC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G68660 Ribosomal protein L12/ ATP-dep... Lus10041479 0 1
AT1G68660 Ribosomal protein L12/ ATP-dep... Lus10034292 1.0 0.9752
AT4G31870 ATGPX7 glutathione peroxidase 7 (.1) Lus10026887 2.4 0.9410
AT4G31870 ATGPX7 glutathione peroxidase 7 (.1) Lus10003421 5.5 0.8926
AT2G36800 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5,... Lus10003323 6.0 0.9189
AT4G09350 NdhT, CRRJ NADH dehydrogenase-like comple... Lus10042771 7.7 0.9229
AT1G62960 ACS10 ACC synthase 10 (.1) Lus10007021 8.7 0.8669
AT1G28140 unknown protein Lus10041480 8.8 0.8492
AT5G43260 chaperone protein dnaJ-related... Lus10037022 9.2 0.8786
AT5G52420 unknown protein Lus10027493 9.8 0.8866
AT4G34350 HDR, CLB6, ISPH CHLOROPLAST BIOGENESIS 6, 4-hy... Lus10026322 9.8 0.9073

Lus10041479 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.