Lus10041514 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38130 287 / 3e-100 ATMAK3 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
AT5G11340 62 / 3e-12 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT1G03150 39 / 0.0007 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
AT2G06025 39 / 0.001 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012579 384 / 1e-138 AT2G38130 286 / 7e-100 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Lus10008088 56 / 2e-09 AT5G11340 249 / 2e-85 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10013120 51 / 5e-08 AT5G11340 256 / 8e-89 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10042595 41 / 0.0002 AT1G03150 348 / 6e-125 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Lus10037996 41 / 0.0002 AT2G39000 335 / 2e-115 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10009229 39 / 0.0007 AT2G39000 320 / 5e-112 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
Lus10021559 39 / 0.001 AT2G06025 244 / 2e-80 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G435300 316 / 2e-111 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G432400 315 / 2e-111 AT2G38130 296 / 4e-104 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G429200 315 / 3e-111 AT2G38130 299 / 6e-105 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.011G139300 308 / 3e-108 AT2G38130 294 / 1e-102 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G425800 222 / 5e-75 AT2G38130 207 / 2e-69 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.001G433800 121 / 8e-36 AT2G38130 117 / 3e-34 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2)
Potri.006G248900 61 / 1e-11 AT5G11340 280 / 3e-98 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.018G032400 57 / 2e-10 AT5G11340 270 / 4e-94 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.006G142100 40 / 0.0007 AT2G06025 347 / 1e-120 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1)
Potri.008G039300 39 / 0.0008 AT2G39000 387 / 1e-135 Acyl-CoA N-acyltransferases (NAT) superfamily protein (.1), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.2), Acyl-CoA N-acyltransferases (NAT) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0257 Acetyltrans PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Representative CDS sequence
>Lus10041514 pacid=23146704 polypeptide=Lus10041514 locus=Lus10041514.g ID=Lus10041514.BGIv1.0 annot-version=v1.0
ATGGACGGTGAGCGAGGTGTAGAAGGAGACACCCCAAAAGAAGAGAGAGCTACATTCGATGAATCGGAGATAGAGTACGTGAGCTACGGCGGCGAGCATC
ACCTACCGCTAATAATGGGTCTGGTTGATCAGGAGCTGAGTGAACCCTACTCCATCTTCACTTATCGCTACTTCGTATACCTATGGCCCCAGCTTTCCTT
TCTGGCGTTCCATAGAGGGAGATGTGTTGGGACGGTGGTATGCAAAATGGGGGAGCATCGTAATACTACTTTCAGAGGGTACATAGCAATGCTGGTTGTC
ATCAAGCCTTATCGGGGCAAAGGCATTGCTACTGAACTTGTAACCAGATCGATCAGAGCAATGATGGACTCCGGATGTGAAGAGGTAACACTGGAAGCAG
AAGTAACAAATAAAGGTGCTCTTGCACTTTATGGCAGACTGGGGTTCATCAGGGCGAAACGACTGTTTCATTACTACTTGAATGGAGTAGACGCTTTTCG
TCTGAAATTGCGGTTCCCTCAACTTGAGATGAACCCATCTGCCATTAATTTTCTGGACGAGACACAGAGATGA
AA sequence
>Lus10041514 pacid=23146704 polypeptide=Lus10041514 locus=Lus10041514.g ID=Lus10041514.BGIv1.0 annot-version=v1.0
MDGERGVEGDTPKEERATFDESEIEYVSYGGEHHLPLIMGLVDQELSEPYSIFTYRYFVYLWPQLSFLAFHRGRCVGTVVCKMGEHRNTTFRGYIAMLVV
IKPYRGKGIATELVTRSIRAMMDSGCEEVTLEAEVTNKGALALYGRLGFIRAKRLFHYYLNGVDAFRLKLRFPQLEMNPSAINFLDETQR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38130 ATMAK3 Acyl-CoA N-acyltransferases (N... Lus10041514 0 1
AT5G50460 secE/sec61-gamma protein trans... Lus10041552 3.0 0.8382
AT4G26310 elongation factor P (EF-P) fam... Lus10030360 7.4 0.8374
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10016278 10.5 0.8511
AT4G00585 unknown protein Lus10012175 11.4 0.8552
AT4G34700 CIB22, AtCIB22 B22 subunit of eukaryotic mito... Lus10018052 11.7 0.8387
AT5G47570 unknown protein Lus10000735 11.8 0.8457
AT5G49210 unknown protein Lus10036792 15.2 0.8172
AT3G14180 Trihelix ASIL2 Arabidopsis 6B-interacting pr... Lus10029220 15.3 0.8510
AT3G59470 FAR1_related Far-red impaired responsive (F... Lus10026854 15.3 0.8180
AT1G27435 unknown protein Lus10032003 17.5 0.8459

Lus10041514 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.