Lus10041517 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10041517 pacid=23146811 polypeptide=Lus10041517 locus=Lus10041517.g ID=Lus10041517.BGIv1.0 annot-version=v1.0
ATGAGCTACCAGAAGTTCCCCAGCGAGCAGCCGTATCCTCCTCCACCTCCTTCTCAGTCTCCGTATCATGGGAACGAGCCTCCTTACCCGCCGCCGCCGC
CGCAGGTCTATCCTCCTCCGTACGAGACTGAGGGCTATCCGCCTCCGCCTTCGCGCCCTGGTGGTTACGCTCCTCCCTATCCGCCACCGCGCCCCCCTCA
TCAGCACCGATATGATGGCTACCAAGGTTATTTCGCCGGCGCAGCCCAAGGATATCCTCCTCCTCCTCCAGGTCCCCGTAACCAGTATCAACACTACCAT
CAGTATGACCACCACCACAATCACCAGCACCACGACGATTCCGAGGCTTCCTTCCTGCGTGGATGGTATGTCCAATCTCTCGACGTCTTCTAG
AA sequence
>Lus10041517 pacid=23146811 polypeptide=Lus10041517 locus=Lus10041517.g ID=Lus10041517.BGIv1.0 annot-version=v1.0
MSYQKFPSEQPYPPPPPSQSPYHGNEPPYPPPPPQVYPPPYETEGYPPPPSRPGGYAPPYPPPRPPHQHRYDGYQGYFAGAAQGYPPPPPGPRNQYQHYH
QYDHHHNHQHHDDSEASFLRGWYVQSLDVF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10041517 0 1
AT5G44860 unknown protein Lus10036220 1.0 0.9269
AT1G16210 unknown protein Lus10012520 3.0 0.8876
AT3G05670 RING/U-box protein (.1) Lus10015213 4.0 0.8757
AT3G62770 ATATG18A autophagy 18a, Transducin/WD40... Lus10036577 4.9 0.8545
AT5G37600 ATGLN1;1, GLN1;... ARABIDOPSIS THALIANA GLUTAMINE... Lus10017404 5.1 0.8931
AT4G36960 RNA-binding (RRM/RBD/RNP motif... Lus10019341 7.7 0.8463
AT2G45290 Transketolase (.1) Lus10030283 11.8 0.8647
AT5G59550 zinc finger (C3HC4-type RING f... Lus10004712 12.0 0.8508
AT5G19860 Protein of unknown function, D... Lus10013752 12.2 0.8418
AT5G62810 ATPEX14, PED2, ... PEROXISOME DEFECTIVE 2, peroxi... Lus10002378 12.7 0.8349

Lus10041517 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.