Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26740 96 / 2e-26 CCL CCR-like (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012569 [exp] 199 / 1e-67 AT3G26740 95 / 1e-25 CCR-like (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G066400 [exp] 105 / 1e-30 AT3G26740 112 / 2e-32 CCR-like (.1) Potri.003G163402 [exp] 97 / 2e-27 AT3G26740 94 / 1e-25 CCR-like (.1) Potri.014G145500 [exp] 76 / 5e-19 AT3G26740 65 / 2e-14 CCR-like (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07207 [flax] [poplar] Lir1 Light regulated protein Lir1
Representative CDS sequence Show only first row Show all	>Lus10041522 pacid=23146985 polypeptide=Lus10041522 locus=Lus10041522.g ID=Lus10041522.BGIv1.0 annot-version=v1.0 ATGTTGGGAGATGTTTCTGGTCTCATGCATGCACATAGGCCATCGCCGGCCAGTAGGATTGCAACAATATTGAGAGCAATTTCTGTCAATTACAACTCCG CCGTCTCTGTGTTTCCAGCAGAGGCTTGCGAGACTGTGGGTGGAGATGCGTGCTTGGCAGATATGTACCCAGAAGTGAAGCTGCAGCAAATCAAAGCGGA TGACCAAGGCAGAGTTGATTCAGACATTGTTGTCGACAGAGAGTATCTGGAGTACAATGATTCTAAGACGGTGTTCTTAGCTGAAGCGTGTGATGATCTT GGAGGAGAATTCTGCAGCAGCGAGTACCAGAGTGCAGTTTATTAG
AA sequence Show only first row Show all	>Lus10041522 pacid=23146985 polypeptide=Lus10041522 locus=Lus10041522.g ID=Lus10041522.BGIv1.0 annot-version=v1.0 MLGDVSGLMHAHRPSPASRIATILRAISVNYNSAVSVFPAEACETVGGDACLADMYPEVKLQQIKADDQGRVDSDIVVDREYLEYNDSKTVFLAEACDDL GGEFCSSEYQSAVY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26740		CCL	CCR-like (.1)		Lus10041522 [exp]	0	1
AT3G25710	bHLH	TMO5, BHLH32, b...	TARGET OF MONOPTEROS 5, basic ...		Lus10036175 [exp]	7.9	0.8083
AT4G30550		GGP3	gamma-glutamyl peptidase 3, Cl...		Lus10015493 [exp]	8.1	0.8911
					Lus10018837 [exp]	10.6	0.8882
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	12.4	0.8852
AT4G30830			Protein of unknown function, D...		Lus10035817 [exp]	14.6	0.7008
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Lus10000782 [exp]	14.8	0.8183
AT5G15940			NAD(P)-binding Rossmann-fold s...		Lus10016771 [exp]	15.3	0.8295
					Lus10009927 [exp]	15.9	0.8836
					Lus10029490 [exp]	17.0	0.7380
					Lus10017955 [exp]	18.8	0.8832

Compare expression of checked genes

Lus10041522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.