Lus10041533 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27435 103 / 7e-31 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012558 132 / 7e-42 AT1G27435 106 / 5e-32 unknown protein
Lus10032003 118 / 2e-36 AT1G27435 107 / 5e-32 unknown protein
Lus10035173 115 / 2e-35 AT1G27435 107 / 3e-32 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325000 111 / 8e-34 AT1G27435 103 / 1e-30 unknown protein
PFAM info
Representative CDS sequence
>Lus10041533 pacid=23146691 polypeptide=Lus10041533 locus=Lus10041533.g ID=Lus10041533.BGIv1.0 annot-version=v1.0
ATGGCAGGAGGAGCGTTTTGGGGAACAAGAGTAATGGAGATAGTGAAGAAGCATGACTCTGGAGGACTTGTCTGGAAAAGAATAAAGCTCACCCCTTCCC
GCAAAGCCAACGCCAAGAAGCGCCTCCTCCGCGTCTGGCAGAATGAGGCTGTCTTGAGGGCATGCGCTGAACCACCACCTTCCACCAGATCCGCAAACGA
AGCAGCTGCAGCTGGAAAGGGAGATGCAGATGTTAATAATAACACCAATTCCTACTCAAGTTAG
AA sequence
>Lus10041533 pacid=23146691 polypeptide=Lus10041533 locus=Lus10041533.g ID=Lus10041533.BGIv1.0 annot-version=v1.0
MAGGAFWGTRVMEIVKKHDSGGLVWKRIKLTPSRKANAKKRLLRVWQNEAVLRACAEPPPSTRSANEAAAAGKGDADVNNNTNSYSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G27435 unknown protein Lus10041533 0 1
AT1G20580 Small nuclear ribonucleoprotei... Lus10030747 1.7 0.8240
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10014843 2.8 0.8176
AT5G05610 Alfin AL1 alfin-like 1 (.1.2) Lus10009889 3.5 0.8131
AT3G14180 Trihelix ASIL2 Arabidopsis 6B-interacting pr... Lus10008141 3.7 0.7820
AT5G13470 unknown protein Lus10005318 4.0 0.7751
AT5G40570 Surfeit locus protein 2 (SURF2... Lus10003658 5.5 0.7963
AT3G24080 KRR1 family protein (.1.2) Lus10028084 5.7 0.7976
AT3G14180 Trihelix ASIL2 Arabidopsis 6B-interacting pr... Lus10013179 6.0 0.7839
AT5G67320 HOS15 high expression of osmotically... Lus10024972 14.1 0.7711
AT3G24080 KRR1 family protein (.1.2) Lus10025633 15.2 0.7649

Lus10041533 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.