Lus10041538 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G02000 127 / 2e-38 ROXY1 Thioredoxin superfamily protein (.1)
AT5G14070 118 / 5e-35 ROXY2 Thioredoxin superfamily protein (.1)
AT1G28480 107 / 7e-31 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT4G15690 105 / 2e-30 Thioredoxin superfamily protein (.1)
AT4G15670 105 / 3e-30 Thioredoxin superfamily protein (.1)
AT4G15700 105 / 3e-30 Thioredoxin superfamily protein (.1)
AT4G15660 105 / 3e-30 Thioredoxin superfamily protein (.1)
AT4G15680 103 / 1e-29 Thioredoxin superfamily protein (.1)
AT5G18600 97 / 5e-27 Thioredoxin superfamily protein (.1)
AT3G21460 94 / 6e-26 Glutaredoxin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035183 154 / 6e-49 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10011333 136 / 8e-42 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10023295 115 / 1e-33 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Lus10013962 113 / 3e-33 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10038514 111 / 3e-32 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10039867 108 / 5e-31 AT1G28480 127 / 7e-39 Thioredoxin superfamily protein (.1)
Lus10018631 107 / 9e-31 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1)
Lus10033965 103 / 9e-30 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Lus10002887 102 / 6e-29 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325800 157 / 8e-51 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.001G060600 143 / 6e-45 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.003G167000 140 / 6e-44 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.017G017300 109 / 3e-31 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1)
Potri.004G049800 108 / 6e-31 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.008G214500 104 / 5e-30 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.007G134800 105 / 1e-29 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1)
Potri.010G021800 102 / 5e-29 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.011G058800 100 / 8e-28 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
Potri.008G214600 97 / 4e-27 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10041538 pacid=23146789 polypeptide=Lus10041538 locus=Lus10041538.g ID=Lus10041538.BGIv1.0 annot-version=v1.0
ATGTACCAAACAGAATCCTGGTACTTGGTAGCAGCAGCAGCAGGAGGAACGAGATCAAGAACAAGCGAAGGACTTGAATTAGGCGTGGAAAGAATACAGA
GGCTGGCTGAGAGGAACGCGGTAGTGATATTCAGCATGAGCAGCTGCTGCATGTGCCACGTCATCAAGCGCCTCTTCTGCAGCATGGGTGTTAACCCCAC
CGTCTACGAGCTTGACCACCAAGATGACCCCTTTACTGCCAACGACATGGAAATGGCTCTCCTCACCCTCCTCGGCGGTACTTCCTCCTCCTCCTCCTCT
GCCGTCCCTGTCGTCTTCATCGGCGGCAAGCTGATCGGGGGAATGGACAGAGTCATGGCTTCTCACATTAATGGAACCCTCGTCCCTCTACTCAAACAAG
CCGGCGCTCTCTGGCTCTAG
AA sequence
>Lus10041538 pacid=23146789 polypeptide=Lus10041538 locus=Lus10041538.g ID=Lus10041538.BGIv1.0 annot-version=v1.0
MYQTESWYLVAAAAGGTRSRTSEGLELGVERIQRLAERNAVVIFSMSSCCMCHVIKRLFCSMGVNPTVYELDHQDDPFTANDMEMALLTLLGGTSSSSSS
AVPVVFIGGKLIGGMDRVMASHINGTLVPLLKQAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14070 ROXY2 Thioredoxin superfamily protei... Lus10041538 0 1
AT1G22130 MADS AGL104 AGAMOUS-like 104 (.1) Lus10016809 1.4 0.9753
AT1G44760 Adenine nucleotide alpha hydro... Lus10018190 2.6 0.9603
AT2G45190 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, AB... Lus10032240 5.8 0.9713
AT2G45190 YABBY FIL, YAB1, AFO YABBY1, FILAMENTOUS FLOWER, AB... Lus10024603 7.5 0.9694
AT1G15910 FDM1 factor of DNA methylation 1, X... Lus10026076 7.7 0.9610
AT3G02645 Plant protein of unknown funct... Lus10031159 11.0 0.9606
AT2G02540 ZF_HD ATHB21, ZFHD4, ... ZINC FINGER HOMEODOMAIN 3, ZIN... Lus10038135 11.3 0.9610
AT3G06520 agenet domain-containing prote... Lus10017088 15.4 0.9504
AT1G68480 C2H2ZnF JAG JAGGED, C2H2 and C2HC zinc fin... Lus10041443 15.5 0.9582
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10041924 17.7 0.9536

Lus10041538 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.