Lus10041539 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G26980 168 / 5e-55 MUB4 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
AT4G24990 153 / 5e-49 ATGP4 Ubiquitin family protein (.1)
AT1G22050 125 / 4e-38 MUB6 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
AT1G77870 124 / 2e-37 MUB5 membrane-anchored ubiquitin-fold protein 5 precursor (.1)
AT5G15460 114 / 9e-34 MUB2 membrane-anchored ubiquitin-fold protein 2 (.1.2)
AT3G01050 104 / 1e-29 MUB1 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10035184 193 / 9e-65 AT3G26980 178 / 3e-59 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10032014 192 / 2e-64 AT3G26980 174 / 9e-58 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Lus10012555 211 / 3e-64 AT5G13990 608 / 0.0 exocyst subunit exo70 family protein C2 (.1)
Lus10030704 117 / 4e-35 AT5G15460 150 / 2e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Lus10013190 118 / 6e-35 AT5G15460 150 / 8e-48 membrane-anchored ubiquitin-fold protein 2 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G325900 178 / 4e-59 AT3G26980 169 / 7e-56 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Potri.017G068100 166 / 3e-54 AT3G26980 154 / 1e-49 membrane-anchored ubiquitin-fold protein 4 precursor (.1)
Potri.012G103100 154 / 2e-49 AT4G24990 207 / 5e-71 Ubiquitin family protein (.1)
Potri.015G101200 145 / 5e-46 AT4G24990 197 / 6e-67 Ubiquitin family protein (.1)
Potri.017G090700 120 / 4e-36 AT3G01050 157 / 7e-51 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.004G124600 115 / 2e-34 AT3G01050 155 / 2e-50 membrane-anchored ubiquitin-fold protein 1 precursor (.1)
Potri.002G091800 106 / 2e-30 AT1G22050 124 / 5e-38 membrane-anchored ubiquitin-fold protein 6 precursor (.1)
PFAM info
Representative CDS sequence
>Lus10041539 pacid=23146898 polypeptide=Lus10041539 locus=Lus10041539.g ID=Lus10041539.BGIv1.0 annot-version=v1.0
ATGCCGGAGGAGGATTTTGTTGAGCTCAAGTTCAGATTATACGATGGGACCGATATTGGACCGTTTAGGTATTCTCCGGCATCCACGGTTTCCGTTTTGA
AGGAAAGGATCGTCGCTGAGTGGCCAAAAGATAAGAAAACTGCACCCAAGGGAGCAAATGACATCAAACTGATAAATGCTGGGAAAATTTTGGAGAACAC
CAAGACTGTTGGCCAGTGTAGAGCCCCTTTTGGAGAGCTTCCGAACAGTGTTATCACAATGCATGTCGTTGTACAGCCGTCGTTGGTGAAAGCAAAAACA
GGTAACAAGATCAAATGGATACTTGCTAGAAATGGCTGCAGTTTCATCTCCTGTGTACAGTATATCGGCGACCCATTTGGGAAGGCTCTATGCTACATGG
GAATGTCTTTTTGA
AA sequence
>Lus10041539 pacid=23146898 polypeptide=Lus10041539 locus=Lus10041539.g ID=Lus10041539.BGIv1.0 annot-version=v1.0
MPEEDFVELKFRLYDGTDIGPFRYSPASTVSVLKERIVAEWPKDKKTAPKGANDIKLINAGKILENTKTVGQCRAPFGELPNSVITMHVVVQPSLVKAKT
GNKIKWILARNGCSFISCVQYIGDPFGKALCYMGMSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G26980 MUB4 membrane-anchored ubiquitin-fo... Lus10041539 0 1
Lus10040104 2.0 0.8503
AT1G66240 ATX1, ATATX1 homolog of anti-oxidant 1 (.1.... Lus10028859 2.2 0.8935
AT1G50670 OTU-like cysteine protease fam... Lus10040075 2.8 0.8642
AT1G04960 Protein of unknown function (D... Lus10033807 3.5 0.8532
AT5G25540 CID6 CTC-interacting domain 6 (.1) Lus10041253 4.2 0.8320
AT4G39235 unknown protein Lus10004160 5.5 0.8380
AT3G26980 MUB4 membrane-anchored ubiquitin-fo... Lus10032014 9.7 0.7947
AT2G31130 unknown protein Lus10013926 9.8 0.8257
AT5G46030 unknown protein Lus10025438 12.8 0.8235
AT3G11620 BAS1 alpha/beta-Hydrolases superfam... Lus10021300 15.0 0.8124

Lus10041539 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.