Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26960 149 / 1e-46 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 148 / 2e-46 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G13140 133 / 1e-39 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 43 / 9e-06 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 41 / 4e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 40 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 39 / 0.0005 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012553 [exp] 241 / 1e-83 AT5G41050 168 / 3e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10032018 [exp] 184 / 9e-61 AT5G41050 162 / 2e-51 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10035187 [exp] 180 / 4e-59 AT5G41050 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 44 / 4e-06 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 40 / 0.0001 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10005086 [exp] 40 / 0.0003 AT5G15780 133 / 5e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10034365 [exp] 40 / 0.0003 AT5G15780 129 / 7e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 39 / 0.0003 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 39 / 0.0005 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G326200 [exp] 196 / 1e-65 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 196 / 1e-65 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G060500 [exp] 159 / 1e-49 AT5G13140 185 / 3e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 137 / 6e-41 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 8e-09 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 49 / 2e-07 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 45 / 1e-06 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 44 / 3e-06 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10041541 pacid=23147060 polypeptide=Lus10041541 locus=Lus10041541.g ID=Lus10041541.BGIv1.0 annot-version=v1.0 ATGGGTTTCGTTTACTGTGATATCTGCTCTAATAACAGCTTTACCAAACACAGCTACTTCATGCCAGGCGTAGAAGTCAGAATAGAGTGCAAGTTCAAAG CAAGTGCACCGAAAACGAGAGAGCAGATAGCATTCTCAGTAAACAGGACAACAAACAGGAACGGAATGTACAAATTAGAAATACCAGCTGTTGACGGGAT CGAGTGTGCAGAGTCAGCCATTGCATCATCTTGTGAAGCAAGCTTGATGTGGACTCCCTCGAAATCATGCAATGTTCCCGGATACAGATCTACATCAGAT GAGATAGAGATCAAAGCCAGGCAACCAAATCTTTGCGTCTACAGCCTCAATGCATTGAATTTCAGACCTTCCAAAAGAAATATCTCTATGTGTGGACATT AG
AA sequence Show only first row Show all	>Lus10041541 pacid=23147060 polypeptide=Lus10041541 locus=Lus10041541.g ID=Lus10041541.BGIv1.0 annot-version=v1.0 MGFVYCDICSNNSFTKHSYFMPGVEVRIECKFKASAPKTREQIAFSVNRTTNRNGMYKLEIPAVDGIECAESAIASSCEASLMWTPSKSCNVPGYRSTSD EIEIKARQPNLCVYSLNALNFRPSKRNISMCGH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10041541 [exp]	0	1
AT5G41050			Pollen Ole e 1 allergen and ex...		Lus10012553 [exp]	1.0	0.9194
AT1G67590			Remorin family protein (.1.2)		Lus10036996 [exp]	1.4	0.9148
AT1G04590		EMB2748	unknown protein		Lus10015943 [exp]	2.0	0.8621
AT2G02850		ARPN	plantacyanin (.1)		Lus10018938 [exp]	3.0	0.8997
AT2G45490		ATAUR3	ataurora3 (.1)		Lus10020580 [exp]	3.9	0.8604
AT1G18440			Peptidyl-tRNA hydrolase family...		Lus10042977 [exp]	5.5	0.8057
AT5G42890		ATSCP2	sterol carrier protein 2 (.1)		Lus10042654 [exp]	6.6	0.7653
AT2G22600			RNA-binding KH domain-containi...		Lus10002662 [exp]	6.6	0.8176
AT5G47520		AtRABA5a	RAB GTPase homolog A5A (.1)		Lus10039052 [exp]	7.1	0.8051
AT5G50090			unknown protein		Lus10042139 [exp]	8.1	0.7811

Compare expression of checked genes

Lus10041541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.