Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G50460 82 / 3e-22 secE/sec61-gamma protein transport protein (.1) AT4G24920 82 / 3e-22 secE/sec61-gamma protein transport protein (.1) AT3G48570 76 / 7e-20 secE/sec61-gamma protein transport protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012539 [exp] 106 / 2e-31 AT5G50460 127 / 4e-40 secE/sec61-gamma protein transport protein (.1) Lus10035206 [exp] 90 / 3e-25 AT5G50460 127 / 1e-40 secE/sec61-gamma protein transport protein (.1) Lus10019065 [exp] 61 / 1e-13 AT4G31985 100 / 2e-29 Ribosomal protein L39 family protein (.1) Lus10032037 [exp] 0 / 1 AT3G48560 96 / 3e-23 TRIAZOLOPYRIMIDINE RESISTANT 5, IMIDAZOLE RESISTANT 1, ACETOLACTATE SYNTHASE, ACETOHYDROXY ACID SYNTHASE, chlorsulfuron/imidazolinone resistant 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G329400 [exp] 84 / 3e-23 AT5G50460 99 / 2e-29 secE/sec61-gamma protein transport protein (.1) Potri.012G098400 [exp] 82 / 5e-22 AT5G50460 104 / 2e-31 secE/sec61-gamma protein transport protein (.1) Potri.015G097300 [exp] 81 / 1e-21 AT5G50460 103 / 3e-31 secE/sec61-gamma protein transport protein (.1) Potri.017G064032 [exp] 62 / 2e-14 AT5G50460 101 / 4e-30 secE/sec61-gamma protein transport protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00584 [flax] [poplar] SecE SecE/Sec61-gamma subunits of protein translocation complex
Representative CDS sequence Show only first row Show all	>Lus10041552 pacid=23146885 polypeptide=Lus10041552 locus=Lus10041552.g ID=Lus10041552.BGIv1.0 annot-version=v1.0 ATGGACGCCATTGACAACGTCTTCGATCCGCTCAGGGAGTTCGCCAAGGACAGCGTCCGCCTCGTCAAGCGTTGCCACAAACCCGATCGGAAAGAATTTT CCAAGGTTGCGGTGCGAACGGCGATAGGGTTTGTTGTGATGGGATTCGTGGGGTTCTTCGTTAAGCTCATTTTCATCCCCATCAATAACATCATCGTCGG ATCTGGTGGCGTTGGGAAGCATGGAGCAGTTGCTGGGGAAATTTCTGCAGCATCTGATGAAGAGATTAGAGAACACAACCCAATGTAG
AA sequence Show only first row Show all	>Lus10041552 pacid=23146885 polypeptide=Lus10041552 locus=Lus10041552.g ID=Lus10041552.BGIv1.0 annot-version=v1.0 MDAIDNVFDPLREFAKDSVRLVKRCHKPDRKEFSKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSGGVGKHGAVAGEISAASDEEIREHNPM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G50460			secE/sec61-gamma protein trans...		Lus10041552 [exp]	0	1
AT2G38130		ATMAK3	Acyl-CoA N-acyltransferases (N...		Lus10041514 [exp]	3.0	0.8382
AT2G17390		AKR2B	ankyrin repeat-containing 2B (...		Lus10026575 [exp]	9.7	0.7978
AT1G76200			unknown protein		Lus10034571 [exp]	11.5	0.8083
AT2G42210		ATOEP16-3	Mitochondrial import inner mem...		Lus10016278 [exp]	12.0	0.8374
AT4G29520			unknown protein		Lus10008575 [exp]	15.7	0.8198
AT4G30660			Low temperature and salt respo...		Lus10035809 [exp]	17.0	0.7821
AT1G23750			Nucleic acid-binding, OB-fold-...		Lus10030617 [exp]	22.0	0.8110
AT2G18040		PIN1AT	"peptidylprolyl cis/trans isom...		Lus10025967 [exp]	22.6	0.7774
AT4G31990		AAT3, ATAAT1, A...	ASPARTATE AMINOTRANSFERASE DEF...		Lus10001938 [exp]	22.6	0.7854
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Lus10036786 [exp]	24.8	0.8004

Compare expression of checked genes

Lus10041552 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.