Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27100 126 / 5e-39 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012534 [exp] 195 / 3e-66 AT3G27100 150 / 2e-48 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G330400 [exp] 171 / 8e-57 AT3G27100 130 / 2e-40 unknown protein Potri.017G069200 [exp] 163 / 1e-53 AT3G27100 131 / 7e-41 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10163 [flax] [poplar] EnY2 Transcription factor e(y)2
Representative CDS sequence Show only first row Show all	>Lus10041556 pacid=23146909 polypeptide=Lus10041556 locus=Lus10041556.g ID=Lus10041556.BGIv1.0 annot-version=v1.0 ATGAGGAAATCGGTGAATCGACCTCCGACGCCGGACGCGGCGGAGGAGCAGCAGAAGGAGCCCTCGTTTCATGAAGTTATCAACGTCAAGTTGGTTGAAA GCGGGGAGAAGGAGCGATTAATGGAGCTGCTGAGGGAAAGGTTGATAGAGTGTGGCTGGAAAGACGAGATGAAAGCTCTCTGCAGGGCTTTCATTAAGAA GAAAGGCAGGGATAATGTGACTGTGGATGACCTTGTACATGTGATTACACCAAAAGGCAGAGCATCGATTCCTGATGCAGTAAAGGCCGAGCTATTGCAA AGAATTCGTATGTTTCTAGTTCAAGCCTCCGCGTAG
AA sequence Show only first row Show all	>Lus10041556 pacid=23146909 polypeptide=Lus10041556 locus=Lus10041556.g ID=Lus10041556.BGIv1.0 annot-version=v1.0 MRKSVNRPPTPDAAEEQQKEPSFHEVINVKLVESGEKERLMELLRERLIECGWKDEMKALCRAFIKKKGRDNVTVDDLVHVITPKGRASIPDAVKAELLQ RIRMFLVQASA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27100			unknown protein		Lus10041556 [exp]	0	1
AT3G27100			unknown protein		Lus10012534 [exp]	2.4	0.8512
AT5G45360			F-box family protein (.1)		Lus10007767 [exp]	11.2	0.7995
AT2G03420			unknown protein		Lus10036810 [exp]	12.7	0.8568
AT1G14310			Haloacid dehalogenase-like hyd...		Lus10036740 [exp]	20.7	0.7590
AT4G34090			unknown protein		Lus10041575 [exp]	22.9	0.8363
AT1G12250			Pentapeptide repeat-containing...		Lus10024602 [exp]	27.7	0.8346
AT3G55240			Plant protein 1589 of unknown ...		Lus10030322 [exp]	35.7	0.7704
AT3G52070			unknown protein		Lus10029504 [exp]	35.9	0.8138
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10042461 [exp]	37.8	0.8324
AT1G80230			Rubredoxin-like superfamily pr...		Lus10025745 [exp]	39.4	0.7307

Compare expression of checked genes

Lus10041556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.